Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 2, chloroplastic (PPT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the most accurate delivery estimate.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
PPT2; Os08g0344600; LOC_Os08g25624; OJ1119_B10.35; P0410E11.104; Phosphoenolpyruvate/phosphate translocator 2, chloroplastic; OsPPT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-407
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PPT2
Target Protein Sequence
AVAARSLGRLLLLPPPPPISPDRAGRGRARHVACGAAAGDAKAEEEESGLAKTLQLGALF GLWYLFNIYFNIYNKQVLKVFPYPINITTVQFAVGTVVALFMWITGILRRPKISGAQLFA ILPLAVVHTMGNLFTNMSLGKVAVSFTHTIKAMEPFFSVLLSAIFLGELPTVWVILSLLP IVGGVALASLTEASFNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNINLFSIITVM SFFLLAPVAFLTEGIKITPTVLQSAGLNVKQVLTRSLLAALCFHAYQQVSYMILARVSPV THSVGNCVKRVVVIVTSVLFFRTPVSPINSLGTAIALAGVFLYSQLKRLKPKPKAA
Uniprot No.

Target Background

Function
Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.
Database Links
Protein Families
TPT transporter family, PPT (TC 2.A.7.9) subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PPT2 in rice chloroplasts?

PPT2 in Oryza sativa functions primarily as a transporter that exchanges phosphoenolpyruvate (PEP) across the chloroplast membrane. This protein is crucial for maintaining carbon flux between the cytosol and plastid compartments in rice cells. PPT2 specifically transports PEP into the chloroplast, which is essential for the shikimate pathway that produces aromatic amino acids and various secondary metabolites. In developing rice tissues, PPT exhibits stable low expression levels compared to other plastidial transporters, suggesting its specialized role in chloroplast metabolism . Unlike the more abundant glucose-6-phosphate transporters (GPTs), PPT2 maintains relatively constant expression during seed development stages, indicating its housekeeping function in maintaining basic metabolic processes rather than developmental regulation.

How does PPT2 expression vary across different rice tissues?

PPT2 demonstrates tissue-specific expression patterns in rice, similar to other chloroplast proteins like cpSRP43 which shows constitutive expression across various organs with highest levels in photosynthetic tissues . Transcriptome analysis reveals that PPT2 maintains more stable expression levels compared to other transporters such as GPT1/2 (glucose-6-phosphate transporters) and GLT (glucose transporters) which show dynamic regulation during development . In developing rice seeds, particularly during starch accumulation phases (50-90 days after flowering), PPT2 shows consistent low-level expression while other transporters like GPT1 are significantly upregulated. This expression pattern suggests PPT2 may function more as a maintenance transporter rather than being directly involved in developmental processes like starch biosynthesis.

What genomic and protein characteristics define rice PPT2?

The rice PPT2 is encoded in the nuclear genome and the mature protein is targeted to the chloroplast membrane, containing characteristic transmembrane domains typical of plastidial phosphate translocator family proteins. Like other chloroplastic proteins in rice, it contains an N-terminal transit peptide that directs the protein to chloroplasts after cytosolic synthesis . The protein belongs to the phosphate translocator (PT) family, characterized by a conserved PT domain and multiple membrane-spanning regions. Proper subcellular localization can be confirmed through chloroplast import assays or through GFP fusion proteins expressed in plant cells, similar to methods used for other chloroplastic proteins in rice .

What are the optimal methods for cloning and expressing recombinant rice PPT2?

For successful cloning and expression of recombinant Oryza sativa PPT2, researchers should follow established protocols for chloroplastic membrane proteins:

  • Gene Amplification: Isolate total RNA from young rice leaves where PPT2 is expressed. Amplify the full-length coding sequence using RT-PCR with gene-specific primers designed based on the Oryza sativa subsp. japonica genome sequence.

  • Vector Construction: Clone the PPT2 cDNA into an appropriate expression vector with a fusion tag (e.g., His-tag, GFP, or RFP) to facilitate purification and detection. For plant expression, vectors with plant-compatible promoters (35S or Ubiquitin) are recommended .

  • Expression Systems:

    • For heterologous expression in plants: Use Agrobacterium-mediated transformation of Nicotiana benthamiana leaves for transient expression, similar to methods used for other rice proteins . Infiltrate Agrobacterium strain UIA143 carrying the expression construct at OD600 of 0.15 in infiltration buffer (28 mM glucose, 50 mM MES, 2 mM Na3PO4·12H2O, 0.1 mM acetosyringone).

    • For stable transformation: Use the floral dip method for Arabidopsis or established protocols for rice transformation .

    • For bacterial expression: Express membrane fragments or soluble domains in E. coli using specialized strains designed for membrane proteins.

  • Verification: Confirm successful expression through Western blot analysis using antibodies against the fusion tag or custom antibodies against PPT2.

How can researchers effectively measure PPT2 transport activity?

To assess the transport activity of recombinant PPT2, researchers can employ the following methodologies:

  • Reconstitution in Liposomes:

    • Purify recombinant PPT2 from expression systems using affinity chromatography.

    • Reconstitute the purified protein into liposomes prepared with plant chloroplast lipids.

    • Measure PEP/Pi exchange by tracking radiolabeled substrate uptake or release.

  • Chloroplast Isolation and Transport Assays:

    • Isolate intact chloroplasts from wild-type and PPT2-overexpressing or knockout rice plants.

    • Conduct comparative transport assays using [14C]-labeled PEP to measure transport rates.

    • Calculate kinetic parameters (Km, Vmax) to characterize the transport efficiency.

  • In vivo Metabolic Flux Analysis:

    • Supply plants with 13C-labeled glucose or other carbon sources.

    • Track the movement of labeled carbon through metabolic pathways using mass spectrometry.

    • Compare flux patterns between wild-type and PPT2-modified plants to determine the impact of PPT2 on carbon allocation.

These approaches provide complementary data on PPT2 function, from direct biochemical characterization to physiological relevance in the plant system.

What techniques are effective for analyzing PPT2 localization in rice cells?

To confirm the subcellular localization of PPT2 in rice cells, researchers can employ multiple complementary approaches:

  • Fluorescent Protein Fusion: Create C-terminal or N-terminal fusions of PPT2 with GFP or other fluorescent proteins, excluding the transit peptide for C-terminal fusions. Express these constructs in rice protoplasts or through stable transformation and visualize using confocal microscopy to confirm chloroplast localization, similar to methods used for other chloroplastic proteins in rice .

  • Immunolocalization: Develop specific antibodies against PPT2 and use them for immunogold labeling combined with electron microscopy to precisely localize PPT2 within the chloroplast membrane system.

  • Subcellular Fractionation: Isolate chloroplasts from rice leaves and further fractionate them into envelope, stroma, and thylakoid fractions. Analyze the presence of PPT2 in different fractions by Western blotting.

  • Proteomic Analysis of Isolated Chloroplast Membranes: Use mass spectrometry-based proteomics to identify PPT2 in purified chloroplast envelope fractions, applying approaches similar to those used for identifying Lewis A bearing glycoproteins from Oryza sativa .

These methods in combination provide robust evidence for PPT2 localization and can help determine its exact position within the chloroplast membrane system.

How does PPT2 contribute to carbon partitioning in rice metabolism?

PPT2 plays a critical role in carbon partitioning between cytosolic and plastidial compartments in rice cells. Transcriptome analysis of starch biosynthesis has revealed that PPT2 works alongside other transporters such as GPT (glucose-6-phosphate transporter), GLT (glucose transporter), and TPT (triose phosphate transporter) to facilitate the interchange of glycolytic intermediates between cytosol and plastid .

In developing rice seeds, the relative expression patterns of these transporters indicate a coordinated carbon allocation system:

TransporterExpression Pattern in Developing SeedsRelative AbundancePrimary Function
GPT1Highly upregulated at 50-90 DAFHighest (6.8-fold higher than GPT2)Primary G6P import into plastids
GPT2Up-down-up patternModerateSecondary G6P transport
GLT4Upregulated at 50-90 DAFModerate (lower than GPT1)Glucose transport
TPTStable low level or downregulatedLowTriose phosphate exchange
PPT2Stable low level or downregulatedLowPEP transport

While GPT1 appears to be the dominant transporter providing carbon skeletons for starch synthesis in developing rice seeds, PPT2 maintains a complementary role by supplying PEP for aromatic amino acid synthesis and other essential metabolic pathways within the chloroplast . This coordinated transport system ensures balanced distribution of carbon resources between energy production, starch synthesis, and essential biosynthetic pathways.

What is known about the regulatory mechanisms controlling PPT2 expression in rice?

The regulation of PPT2 expression in rice involves multiple mechanisms that respond to developmental, metabolic, and environmental signals. Unlike other plastidial transporters that show dramatic expression changes during development, PPT2 exhibits more subtle regulation . Evidence suggests that PPT2 regulation involves:

  • Developmental Regulation: PPT2 maintains relatively stable expression during seed development, contrasting with transporters like GPT1 that show significant upregulation during starch accumulation phases.

  • Metabolic Feedback: The expression of PPT2 likely responds to the metabolic status of the cell, particularly the availability of PEP and other glycolytic intermediates, helping to balance carbon flux between cytosol and plastid.

  • Coordination with Other Transporters: Transcriptome analysis reveals that plastidial transporters, including PPT2, show coordinated expression patterns, suggesting common regulatory elements controlling the expression of these genes as part of an integrated carbon allocation system .

  • Chloroplast Development Signals: As a chloroplastic protein, PPT2 expression may be coordinated with genes involved in chloroplast biogenesis and development, similar to other chloroplast-targeted proteins like cpSRP43 .

The precise transcription factors and signaling pathways controlling PPT2 expression remain areas for further investigation, as current research has primarily focused on expression patterns rather than regulatory mechanisms.

How do PPT2 mutants or transgenic modifications affect rice phenotype and metabolism?

Based on research with other chloroplastic proteins and transporters in rice, alterations in PPT2 would likely produce significant metabolic and phenotypic effects:

Complementation experiments, similar to those used for other rice proteins , would be essential to confirm that observed phenotypes result specifically from PPT2 alterations rather than unrelated mutations.

How does rice PPT2 differ from PPT homologs in Arabidopsis and other model plants?

Rice PPT2 shares structural and functional similarities with PPT homologs from other plant species, but with notable differences that reflect evolutionary adaptation to different metabolic needs:

These differences highlight the importance of studying rice-specific transporters rather than simply extrapolating findings from dicot model systems.

What are the subspecies-specific variations in PPT2 between japonica and indica rice?

Comparative analysis of japonica and indica rice subspecies reveals potential variations in PPT2 that may contribute to metabolic differences:

  • Sequence Polymorphisms: Like other genes showing variation between rice subspecies, PPT2 may contain single nucleotide polymorphisms (SNPs) or small insertions/deletions that differ between japonica and indica varieties.

  • Expression Differences: Research on amino acid transporters has shown that japonica and indica subspecies can differ significantly in transporter efficiency, with japonica subspecies showing up to 1.5-fold higher efficiency in some cases . Similar subspecies-specific differences might exist for PPT2 expression or activity.

  • Association with Metabolic Traits: Genetic association analyses, similar to those identifying OsLHT1 as a candidate gene associated with aspartate uptake traits between japonica and indica , could potentially reveal PPT2 polymorphisms associated with differences in carbon metabolism or starch accumulation between subspecies.

  • Co-evolution with Metabolic Networks: PPT2 likely co-evolved with other components of carbon metabolism pathways that may differ between japonica and indica subspecies, potentially leading to functional adaptations specific to each subspecies' metabolic requirements.

Further genomic and transcriptomic comparisons between japonica and indica varieties would be necessary to fully characterize these potential subspecies-specific variations in PPT2.

How does PPT2 function integrate with starch biosynthesis pathways in rice endosperm?

PPT2 operates within a complex network of transporters and enzymes that coordinate carbon allocation for starch biosynthesis in developing rice endosperm. Transcriptome analysis indicates that PPT2 functions as part of a transport system that includes GPT1/2, GLT, and TPT to facilitate interchange of glycolytic intermediates between the cytosol and plastid .

The integration of PPT2 with starch biosynthesis can be understood through the following framework:

  • Carbon Source Provision: While GPT1 appears to be the dominant transporter for importing carbon skeletons (primarily as G6P) into plastids for starch synthesis, PPT2 provides a complementary pathway by transporting PEP, which can be converted to other metabolites within the plastid.

  • Metabolic Flexibility: The presence of multiple transporters, including PPT2, provides metabolic flexibility to respond to changing carbon availability and energy requirements during seed development.

  • Coordination with Starch Synthetic Enzymes: The expression pattern of PPT2 needs to be considered alongside key enzymes in starch biosynthesis, including:

    • ADP-glucose pyrophosphorylase (AGPase)

    • Starch synthases (SS)

    • Starch branching enzymes (SBE)

    • Isoamylases (ISA)

  • Temporal Regulation: During seed development (50-90 DAF), when starch accumulation is highest, PPT2 maintains relatively stable expression while starch synthetic enzymes and other transporters like GPT1 are significantly upregulated . This suggests PPT2 provides baseline metabolic support rather than being a rate-limiting step in starch biosynthesis.

What research gaps remain in understanding rice PPT2 function and regulation?

Despite the importance of plastidial transporters in rice metabolism, several significant research gaps remain in our understanding of PPT2:

  • Structure-Function Relationships: Detailed structural characterization of rice PPT2 is lacking, including:

    • Crystal structure determination

    • Identification of key residues for substrate binding and transport

    • Structural basis for transport kinetics and regulation

  • Regulatory Mechanisms: The specific transcriptional and post-translational regulatory mechanisms controlling PPT2 expression and activity remain poorly characterized, including:

    • Identification of transcription factors controlling PPT2 expression

    • Understanding of potential post-translational modifications affecting PPT2 activity

    • Characterization of protein-protein interactions that may regulate PPT2 function

  • Metabolic Impact Assessment: Comprehensive analysis of how PPT2 alterations affect:

    • Global metabolic profiles across different tissues and developmental stages

    • Carbon flux through different metabolic pathways

    • Adaptations to different environmental conditions

  • Breeding Applications: Understanding of how natural PPT2 variants contribute to:

    • Differences in rice grain quality and yield

    • Adaptation to different growing conditions

    • Potential for targeted breeding to optimize carbon allocation

Addressing these research gaps would require integrated approaches combining structural biology, molecular genetics, metabolomics, and field studies to fully understand the role of PPT2 in rice metabolism and its potential applications for crop improvement.

What are the best practices for analyzing PPT2 interaction with other chloroplast membrane proteins?

To effectively analyze PPT2 interactions with other chloroplast membrane proteins, researchers should consider multiple complementary approaches:

  • Yeast Two-Hybrid Membrane Systems:

    • Modified split-ubiquitin yeast two-hybrid systems designed for membrane proteins

    • Screening against libraries of other chloroplast membrane proteins

    • Validation of positive interactions through targeted assays

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of PPT2 in rice or heterologous systems

    • Isolate intact chloroplasts and solubilize membranes with appropriate detergents

    • Perform immunoprecipitation with tag-specific antibodies

    • Identify co-precipitating proteins through mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of PPT2 and candidate interacting proteins with split fluorescent protein fragments

    • Express in rice protoplasts or Nicotiana benthamiana leaves through techniques similar to those used for Lewis A bearing glycoproteins

    • Visualize protein interactions through fluorescence microscopy

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse PPT2 to a promiscuous biotin ligase

    • Express in rice to biotinylate proteins in close proximity to PPT2

    • Isolate biotinylated proteins and identify through mass spectrometry

  • Crosslinking Mass Spectrometry:

    • Apply protein crosslinkers to isolated chloroplasts

    • Digest and analyze crosslinked peptides through specialized mass spectrometry

    • Identify proteins in close physical proximity to PPT2

Each method has strengths and limitations, so combining multiple approaches provides the most reliable picture of PPT2's protein interaction network within the chloroplast membrane.

How can researchers effectively study the impact of environmental stresses on PPT2 function?

To comprehensively assess how environmental stresses affect PPT2 function in rice, researchers should implement multi-level analysis approaches:

  • Transcriptional Regulation:

    • Expose rice plants to various stresses (drought, salinity, temperature extremes, nutrient deficiency)

    • Measure PPT2 transcript levels using RT-qPCR across multiple time points

    • Analyze promoter elements responsive to stress-related transcription factors

  • Protein-Level Responses:

    • Develop specific antibodies against rice PPT2 or use tagged versions

    • Monitor protein abundance, degradation, and post-translational modifications under stress conditions

    • Compare protein levels with transcript abundance to identify post-transcriptional regulation

  • Transport Activity Assessment:

    • Isolate chloroplasts from stressed and control plants

    • Measure PEP transport activity using established protocols

    • Correlate changes in transport activity with stress intensity and duration

  • Metabolic Impact:

    • Conduct targeted metabolomics focusing on PEP-derived compounds

    • Perform 13C-labeling experiments to track carbon flux through PPT2-dependent pathways under stress

    • Compare metabolic responses between wild-type and PPT2-modified plants

  • Phenotypic Analysis:

    • Compare stress responses of wild-type plants versus PPT2 overexpression or knockdown lines

    • Measure physiological parameters including photosynthetic efficiency, growth, and yield components

    • Assess recovery dynamics after stress removal

This multi-faceted approach would provide comprehensive insights into how PPT2 function adapts to environmental challenges and its role in rice stress adaptation mechanisms.

What emerging technologies could advance our understanding of rice PPT2?

Several cutting-edge technologies hold promise for deeper insights into PPT2 function in rice:

  • CRISPR/Cas9 Gene Editing:

    • Generate precise modifications in PPT2 sequence to create allelic series

    • Develop tissue-specific or inducible knockout systems

    • Create tagged versions at endogenous loci for improved physiological relevance

  • Single-Cell Transcriptomics and Proteomics:

    • Map PPT2 expression at cellular resolution across different rice tissues

    • Identify cell type-specific regulatory mechanisms

    • Understand spatial coordination with other transporters and metabolic enzymes

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize PPT2 distribution within chloroplast membranes

    • Live-cell imaging with fluorescent sensors to track metabolite movement in real-time

    • Correlative light and electron microscopy for structural context

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of rice PPT2 in different conformational states

    • Visualize PPT2 in complex with interacting proteins

    • Understand the structural basis of transport mechanism

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptome, proteome, metabolome, fluxome)

    • Genome-scale metabolic modeling incorporating PPT2 function

    • Network analysis to position PPT2 within rice metabolic and regulatory networks

These technologies, particularly when used in combination, would provide unprecedented insights into PPT2 function and regulation in rice, potentially opening new avenues for crop improvement through targeted modification of carbon allocation processes.

How might PPT2 research contribute to rice improvement strategies?

Research on PPT2 and related transporters has significant potential for rice improvement strategies:

  • Yield Enhancement:

    • Optimizing carbon partitioning between source and sink tissues through targeted PPT2 modifications

    • Improving photosynthetic efficiency by balancing metabolite exchange between cytosol and chloroplast

    • Enhancing starch accumulation in grains through coordinated engineering of transport systems

  • Stress Resilience:

    • Modifying PPT2 expression to maintain carbon allocation under stress conditions

    • Engineering PPT2 variants with improved stability under temperature extremes

    • Balancing carbon allocation between growth and defense pathways under biotic stress

  • Nutritional Quality:

    • Redirecting carbon flux to enhance production of essential amino acids derived from PEP

    • Modifying seed composition through altered carbon partitioning during grain filling

    • Enhancing biofortification strategies by understanding carbon allocation to various biosynthetic pathways

  • Breeding Tools:

    • Developing molecular markers based on beneficial PPT2 alleles

    • Understanding subspecies variations between indica and japonica rice to inform crossing strategies

    • Creating diagnostic tools to predict metabolic efficiency based on PPT2 haplotypes

As research continues to elucidate the precise role of PPT2 in rice carbon metabolism, these applications could contribute to developing rice varieties with improved yield, quality, and resilience to meet the challenges of a changing climate and growing population demands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.