Recombinant Oryza sativa subsp. japonica Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Photosystem I Assembly Protein Ycf4

The recombinant Oryza sativa subsp. japonica Photosystem I (PSI) assembly protein Ycf4 (ycf4) is a chloroplast-encoded auxiliary factor critical for the biogenesis and stabilization of the PSI complex in photosynthetic organisms. Ycf4 facilitates the assembly of newly synthesized PSI subunits into functional complexes, ensuring efficient light-driven electron transport in thylakoid membranes . This recombinant protein is commercially available as a purified product for research applications, including immunological assays and structural studies .

Primary Sequence and Domains

The recombinant Ycf4 from Oryza sativa subsp. japonica has a predicted molecular weight of ~22 kDa, consistent with its classification as a small thylakoid membrane protein. Its amino acid sequence (1–185 residues) includes two putative transmembrane domains, which anchor it to the thylakoid membrane . Key structural features include:

FeatureDescription
AA Sequence Length185 residues (MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNIISVLPSQQILFF...)
Membrane AnchoringTwo transmembrane domains, likely mediating interactions with thylakoid-bound PSI components .
ConservationHighly conserved across photosynthetic organisms, from cyanobacteria to higher plants .

Functional Role in PSI Assembly

Ycf4 operates as part of a conserved assembly apparatus that includes Ycf3 and Y3IP1 proteins . Its functions include:

FunctionMechanismEvidence
Subunit ChaperoningBinds newly synthesized PSI polypeptides (e.g., PsaA, PsaB) to prevent aggregation .Co-purification with PSI assembly intermediates in Chlamydomonas .
Complex StabilizationForms a >1500 kDa complex with PSI subunits and COP2, a retinal-binding protein .Electron microscopy of purified complexes .
Regulatory RoleModulates PSI biogenesis in response to environmental stressors (e.g., light intensity) .Mutant studies in Chlamydomonas show reduced PSI accumulation .

Research Gaps and Future Directions

While Ycf4’s role in PSI assembly is well-characterized in model organisms like Chlamydomonas , direct studies on Oryza sativa remain limited. Priorities include:

  1. Structural Elucidation: Experimental validation of the computed model using X-ray crystallography or cryo-EM.

  2. Species-Specific Interactions: Mapping Ycf4’s binding partners in rice to identify crop-specific assembly mechanisms.

  3. Agricultural Applications: Exploring Ycf4’s potential to enhance photosynthetic efficiency in rice under stress conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; LOC_Osp1g00460; Nip069; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNIISVLPSQQILFF PQGVVMSFYGIAGLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLFPRRILYMEIRGQGAIPLTRTDEKFFTPREIEQKAAELAYFLRI PMEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its function in Oryza sativa subsp. japonica?

Ycf4 (Photosystem I assembly protein) is a thylakoid membrane protein encoded by the chloroplast genome that functions as an essential assembly factor for Photosystem I (PSI) in Oryza sativa subsp. japonica (rice). The protein plays a crucial role in the biogenesis and accumulation of PSI complexes by acting as a scaffold for the assembly of PSI subunits. In rice, as in other photosynthetic organisms, Ycf4 forms large protein complexes that facilitate the proper integration of PSI components. Unlike in cyanobacteria where PSI can still assemble at reduced levels without Ycf4, higher plants and green algae show a more strict dependence on Ycf4 for PSI assembly .

How does rice Ycf4 differ from Ycf4 in other plant species?

Rice (Oryza sativa subsp. japonica) Ycf4 shares functional similarity with Ycf4 proteins from other plant species but exhibits specific sequence variations that may affect its stability and interaction with other proteins. While the core function in PSI assembly is conserved, studies have shown that the degree of dependence on Ycf4 varies between species. In Chlamydomonas reinhardtii, Ycf4 deletion completely prevents PSI accumulation, whereas in cyanobacteria, PSI can still assemble at reduced levels without Ycf4 . In tobacco, Ycf4 deletion results in plants that cannot survive autotrophically, requiring additional carbon sources, suggesting its essential role extends beyond just PSI assembly . The rice Ycf4 (UniProt: P0C515) likely shares these critical functions while potentially having rice-specific interaction patterns with other photosynthetic components .

What are the recommended protocols for expressing and purifying recombinant Oryza sativa Ycf4 protein?

For successful expression and purification of recombinant Oryza sativa Ycf4, researchers should consider a multi-step approach that addresses the membrane-bound nature of this protein. Begin with gene cloning using rice chloroplast DNA as a template, followed by insertion into a suitable expression vector containing affinity tags (such as tandem affinity purification tags used successfully with other Ycf4 proteins) . For expression, both prokaryotic (E. coli) and eukaryotic systems can be employed, though membrane proteins often require specialized strains or conditions to prevent aggregation.

Purification should involve gentle detergent solubilization (such as n-dodecyl β-D-maltoside or digitonin) to extract Ycf4 from membranes while maintaining its native conformation. Subsequent purification steps may include affinity chromatography utilizing the engineered tags, followed by size exclusion chromatography to isolate the large Ycf4-containing complexes. For analysis of Ycf4 in complex with other proteins, sucrose gradient ultracentrifugation followed by ion exchange chromatography has proven effective in isolating intact Ycf4 complexes .

How can researchers effectively analyze Ycf4-protein interactions in rice chloroplasts?

To analyze Ycf4-protein interactions in rice chloroplasts, several complementary approaches are recommended. Co-immunoprecipitation using antibodies against Ycf4 (such as the commercially available antibody CSB-PA314345XA01OFG) can capture Ycf4 along with its interacting partners, which can then be identified through mass spectrometry. For a more comprehensive analysis, tandem affinity purification followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been successfully employed in other species to identify components of the Ycf4 complex .

In addition, molecular docking studies can predict potential interaction interfaces between Ycf4 and other photosynthetic proteins. Researchers should consider analyzing interactions between full-length Ycf4 and truncated versions with various proteins involved in photosynthesis, including PSI subunits (PsaA, PsaB, PsaC), PSII components, ATP synthase subunits, and ribosomal proteins. The ClusPro 2.0 server can be utilized for this purpose, followed by analysis of hydrogen bonds and interaction energies using tools like DIMPLOT . These computational predictions should then be validated through experimental approaches such as yeast two-hybrid assays or bimolecular fluorescence complementation.

What methods are most effective for studying Ycf4 localization and dynamics in rice chloroplasts?

For studying Ycf4 localization and dynamics in rice chloroplasts, a combination of microscopy and biochemical fractionation techniques is most effective. Confocal microscopy using fluorescently-tagged antibodies against Ycf4 can visualize its distribution within chloroplasts. For higher resolution, immunogold labeling combined with transmission electron microscopy (TEM) can precisely localize Ycf4 within thylakoid membranes and determine its association with other photosynthetic complexes.

Biochemical approaches should include chloroplast isolation followed by membrane fractionation to separate thylakoid from stromal components. Subsequent separation of thylakoid membrane complexes using blue native polyacrylamide gel electrophoresis (BN-PAGE) can identify Ycf4-containing complexes. For studying the dynamics of Ycf4 incorporation into PSI, pulse-chase protein labeling experiments can track newly synthesized PSI polypeptides associating with the Ycf4 complex over time, as demonstrated in Chlamydomonas . These approaches collectively provide insights into both the spatial distribution and temporal dynamics of Ycf4 function in chloroplast development and PSI assembly.

How do mutations in specific domains of rice Ycf4 affect PSI assembly and plant viability?

The severity of phenotypic effects depends on which domain is affected. Studies in tobacco demonstrate that complete deletion of Ycf4 results in plants that cannot grow autotrophically and require exogenous carbon sources, with leaves that initially develop as green but gradually bleach out . This suggests that in rice, severe mutations affecting critical functional domains would likely produce similar photoautotrophic growth defects. Mutations in regions responsible for interaction with specific PSI subunits might result in partial assembly of PSI, leading to intermediate phenotypes with reduced photosynthetic efficiency rather than complete loss of viability.

What is the relationship between Ycf4 expression levels and chloroplast development in rice?

The relationship between Ycf4 expression levels and chloroplast development in rice appears to be tightly coupled, based on evidence from studies in other plants. Optimal Ycf4 expression is necessary for proper chloroplast development through its role in PSI assembly. In tobacco Ycf4 deletion mutants, chloroplast ultrastructure is significantly altered, with plants exhibiting a gradient of chlorophyll content depending on leaf age – newly emerged leaves are green but gradually bleach with maturity .

In rice, we would expect similar patterns where Ycf4 expression would correlate with developmental stages of chloroplasts. During early leaf development, high Ycf4 expression would facilitate rapid assembly of PSI complexes needed for establishing photosynthetic machinery. Reduced expression or function of Ycf4 would likely impair chloroplast biogenesis, resulting in pale or yellow-green phenotypes similar to those observed in other chloroplast development mutants in rice, such as the YL4 mutant . Additionally, environmental stressors that affect chloroplast development would likely influence Ycf4 expression patterns, suggesting that Ycf4 may serve as a marker for chloroplast developmental status in rice.

How does rice Ycf4 compare functionally with Ycf4 proteins from other model organisms?

Rice Ycf4 shares core functional characteristics with Ycf4 proteins from other photosynthetic organisms, but with notable differences in the degree of necessity for photosynthetic function. In Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI accumulation, with deletion mutants completely lacking PSI complexes . By contrast, cyanobacterial Ycf4 mutants can still assemble PSI, albeit at reduced levels, indicating a less critical role . Rice Ycf4 likely occupies a position similar to other higher plants where the protein is essential for efficient photosynthesis.

In tobacco, Ycf4 deletion results in plants that cannot survive autotrophically and require external carbon sources, with leaves that initially develop as green but gradually bleach . This phenotype suggests that the functional importance of Ycf4 extends beyond just structural assembly of PSI and may include regulatory roles in chloroplast gene expression or energy metabolism. Rice Ycf4 likely shares this broader functionality, particularly given the conservation of photosynthetic mechanisms across flowering plants. The differences in Ycf4 function across evolutionary lineages reflect adaptations in photosynthetic machinery and assembly processes specific to each organism's ecological niche.

How has Ycf4 evolved in different rice subspecies and what implications does this have for rice breeding?

The evolution of Ycf4 across different rice subspecies represents an important area for investigation with significant breeding implications. While specific evolutionary studies of Ycf4 across rice subspecies are not directly addressed in the provided references, we can infer potential patterns based on broader genomic studies. The japonica and indica subspecies of rice show numerous genomic differences that affect various traits, including photosynthetic efficiency and chloroplast development . These subspecies distinctions likely extend to variations in Ycf4 sequence or expression patterns.

Inter-subspecific crosses between indica and japonica rice have been utilized to develop high-yielding varieties (HYVs) . Given Ycf4's essential role in photosynthesis, subspecies-specific variations in this gene could contribute to differences in photosynthetic efficiency, chloroplast development, and ultimately yield potential. Comparative analyses of Ycf4 sequences and expression patterns across diverse rice germplasm could identify beneficial alleles for breeding programs. Additionally, understanding the co-evolution of Ycf4 with other photosynthetic components could explain the superior performance of certain hybrid combinations. This knowledge would be valuable for molecular breeding approaches aimed at optimizing photosynthetic efficiency and yield in rice varieties adapted to different environmental conditions.

What are the common challenges in working with recombinant rice Ycf4 and how can they be addressed?

ChallengeCauseSolution Strategy
Low expression levelsMembrane protein nature of Ycf4Use specialized expression systems (C41/C43 E. coli strains); lower induction temperature (16-18°C); add solubility tags (MBP, SUMO)
Protein instabilityRemoval from native membrane environmentInclude appropriate detergents (n-dodecyl β-D-maltoside, digitonin) in all buffers; avoid freeze-thaw cycles
Poor solubilityHydrophobic transmembrane domainsOptimize detergent:protein ratio; consider nanodiscs or liposome reconstitution
Loss of function after purificationDisruption of protein-lipid interactionsUse milder purification conditions; maintain lipid components during purification
Difficult antibody detectionLow immunogenicity or epitope accessibilityUse polyclonal antibodies targeted to multiple regions; consider epitope tags if antibody detection is problematic

Working with recombinant Ycf4 presents several technical challenges due to its nature as a membrane protein with multiple interaction partners. Researchers must carefully optimize expression conditions, detergent selection, and purification protocols to maintain protein stability and functionality. When troubleshooting poor expression or purification outcomes, systematic testing of different detergents and buffer compositions is recommended .

How can researchers effectively design mutagenesis studies to investigate rice Ycf4 function?

Designing effective mutagenesis studies for rice Ycf4 requires a strategic approach targeting key functional domains while establishing appropriate phenotypic assays. Begin with sequence alignment of Ycf4 across species to identify highly conserved residues, which are likely functionally important. Focus on residues that are conserved between rice and organisms where Ycf4 has been better characterized, such as Chlamydomonas and tobacco .

Site-directed mutagenesis should target specific domains: transmembrane regions for membrane integration, conserved charged residues for protein-protein interactions (similar to R120 in Chlamydomonas), and residues predicted to interact with PSI subunits based on molecular docking studies . For comprehensive analysis, create a library of mutations ranging from conservative substitutions to more disruptive changes.

For phenotypic assessment, develop a multi-parameter evaluation system including chlorophyll fluorescence measurements (Fv/Fm, ΦPSII), PSI activity assays (P700 oxidation), growth rate analysis, and electron microscopy to assess chloroplast ultrastructure. Additionally, establish protein stability assays using approaches such as chloramphenicol treatment to determine if mutations affect Ycf4 stability rather than just function . This comprehensive approach will distinguish between mutations affecting protein stability versus those specifically disrupting functional interactions.

What controls and validation experiments are essential when studying rice Ycf4 protein interactions?

Validation ApproachTechniquePurpose
Reciprocal co-immunoprecipitationPull-down with antibodies against both Ycf4 and putative partnersConfirms bi-directional interaction
Competitive binding assaysAdding excess unlabeled protein to disrupt interactionsDemonstrates specificity of observed interactions
Truncation/domain mappingTesting interaction with systematically truncated proteinsIdentifies specific interaction domains
In vivo confirmationSplit-GFP or FRET in rice protoplastsValidates interactions occur in living cells
Negative controlsTesting interaction with unrelated chloroplast proteinsExcludes non-specific binding
Quantitative analysisSurface Plasmon Resonance or ITCProvides binding affinity measurements

When studying rice Ycf4 protein interactions, rigorous controls and validation experiments are essential to ensure reliable results. For co-immunoprecipitation or pull-down experiments, include negative controls using pre-immune serum and unrelated antibodies to exclude non-specific interactions. When using tagged proteins, perform parallel experiments with the tag alone to identify tag-mediated artifacts .

For mass spectrometry identification of interacting partners, implement stringent statistical criteria and verify interactions through complementary approaches such as yeast two-hybrid assays or bimolecular fluorescence complementation. When conducting molecular docking simulations, validate predictions through mutagenesis of key interface residues to confirm their functional importance . Additionally, perform salt sensitivity tests on purified complexes to assess the nature of interactions (ionic vs. hydrophobic). Finally, functional validation through genetic complementation studies can confirm the biological relevance of identified interactions by demonstrating that disrupting specific interactions impairs PSI assembly or function.

How can knowledge about rice Ycf4 be applied to improve photosynthetic efficiency in crops?

Genetic engineering approaches could include overexpression of optimized Ycf4 variants or modification of its interaction interfaces to enhance PSI assembly efficiency. Since Ycf4 appears to form a scaffold for PSI assembly, engineering more efficient assembly platforms could potentially increase the rate of PSI biogenesis during chloroplast development or after stress-induced damage . Additionally, understanding Ycf4's broader interactions with other photosynthetic components could enable coordinated enhancement of multiple aspects of the photosynthetic apparatus.

The identification of molecular breeding markers based on Ycf4 sequence variations could facilitate the development of rice varieties with enhanced photosynthetic capacity . This knowledge could potentially be transferred to other cereal crops with similar photosynthetic machinery, multiplying the impact across agricultural systems and contributing to global food security goals.

What are the most promising techniques for studying Ycf4 dynamics during chloroplast development in rice?

The most promising techniques for studying Ycf4 dynamics during chloroplast development in rice combine advanced imaging, biochemical analysis, and genetic approaches. Time-resolved confocal microscopy using fluorescently-tagged antibodies against Ycf4 can track its spatial distribution during chloroplast biogenesis. For higher resolution analysis, super-resolution microscopy techniques like STED or PALM can visualize Ycf4 localization relative to developing thylakoid membranes and nascent PSI complexes.

Biochemical approaches should include developmental time-course analysis of Ycf4 complex formation using BN-PAGE combined with western blotting. Pulse-chase protein labeling experiments are particularly valuable for following the dynamics of newly synthesized PSI subunits associating with the Ycf4 complex during chloroplast development . Complementary transcriptomic and proteomic analyses across developmental stages can reveal how Ycf4 expression coordinates with other photosynthetic components.

Inducible genetic systems, such as conditional knockdowns or overexpression lines, allow temporal control of Ycf4 levels at specific developmental stages to determine critical windows for its function. Combined with chloroplast isolation and electron microscopy to visualize ultrastructural changes, these approaches provide a comprehensive view of Ycf4's role throughout chloroplast development . Integration of these multiple data streams through computational modeling could further illuminate the dynamic processes underlying PSI assembly and chloroplast biogenesis in rice.

What open questions remain about rice Ycf4 that should be prioritized in future research?

Several critical questions about rice Ycf4 warrant prioritization in future research:

  • Structural Determinants of Function: What is the detailed three-dimensional structure of rice Ycf4, and how does it differ from Ycf4 in other species? Structural biology approaches including cryo-EM analysis of the purified Ycf4 complex would provide insights into its scaffold function.

  • Regulatory Mechanisms: How is Ycf4 expression and function regulated during development and in response to environmental stresses? Investigations into transcriptional, post-transcriptional, and post-translational regulation would illuminate these processes.

  • Interaction Network Dynamics: What is the precise sequence of interactions that occur during PSI assembly, and how does Ycf4 coordinate with other assembly factors? Time-resolved interaction studies could map this assembly pathway.

  • Subspecies Variations: Do japonica and indica rice subspecies exhibit functional differences in Ycf4 that contribute to variations in photosynthetic efficiency? Comparative functional studies across diverse rice germplasm would address this question .

  • Broader Roles: Does rice Ycf4 play roles beyond PSI assembly, potentially in chloroplast gene expression or signaling? Global analysis of chloroplast processes in Ycf4 mutants could reveal such functions.

  • Environmental Adaptability: How does Ycf4 function adapt to changing environmental conditions, and can these adaptations be enhanced to improve stress tolerance? Studying Ycf4 function under various stresses would provide insights for climate-resilient crop development.

Addressing these questions would significantly advance our understanding of rice Ycf4 function and potentially lead to applications improving crop productivity under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.