Recombinant Oryza sativa subsp. japonica Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs

In Stock

Cat. No.

BT2054584

Source

in vitro E.coli expression system

Synonyms

psbB; LOC_Osp1g00600; Nip090; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47

Quick Inquiry

Description

Table 1: Key Molecular Features

Property	Description
Species	Oryza sativa subsp. japonica (Rice)
Expression System	Escherichia coli
Protein Length	Full-length (1–508 amino acids)
Tag	N-terminal His tag
Purity	>90% (SDS-PAGE)
Storage	Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in Photosynthesis

PsbB is a chlorophyll a-binding apoprotein integral to PSII’s core complex. It stabilizes reaction center proteins (PsbA/D) and coordinates pigments for efficient light absorption . Key functions include:

Light Harvesting: Binds chlorophyll and β-carotene, enabling energy transfer to the PSII reaction center .
Structural Stability: Interacts with PsbH and PsbT to maintain PSII integrity .
Biogenesis: Requires auxiliary proteins like FPB1 (Facilitator of PsbB biogenesis1) for proper assembly .

3.1. Biogenesis and Regulation

FPB1 Dependency: Arabidopsis mutants lacking FPB1 show 70% reduced PsbB accumulation, highlighting its role in PSII assembly .
Transcriptional Stability: psbB mRNA levels remain unchanged in mutants, but polysome association increases, suggesting translational regulation .
Chlorophyll Coordination: PsbB synthesis is tightly coupled to chlorophyll availability, though ribosome profiling indicates no direct translational activation by chlorophyll .

Table 2: Key Research Studies

Study Focus	Key Findings	Source
PsbB Biogenesis	FPB1 stabilizes nascent PsbB during membrane integration
Transcript Processing	HCF152 protein regulates psbB-psbH RNA processing in Arabidopsis
Carotenoid Interaction	PsbB binds β-carotene and lutein, critical for photoprotection

3.2. Experimental Applications

SDS-PAGE Analysis: Used to verify purity (>90%) and molecular weight (~56 kDa) .
Antibody Production: Recombinant PsbB serves as an antigen for polyclonal antibodies .

Table 4: Expression Systems for Recombinant PsbB

System	Yield	Purity	Advantages	Limitations
E. coli	High	>90%	Cost-effective, rapid production	No post-translational modifications
Baculovirus	Moderate	>85%	Eukaryotic folding environment	Lower yield, longer cycle

Future Directions

Structural Studies: Cryo-EM to resolve PsbB’s role in chlorophyll orientation.
Biotechnological Engineering: Optimize PsbB expression in C4 plants for enhanced photosynthetic efficiency.

Product Specs

Form

Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.

Lead Time

Delivery time may vary based on your purchasing method or location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.

Notes

Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. You may use this as a reference for your own preparations.

Shelf Life

The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms can be stored for 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.

Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize the development of your specified tag whenever possible.

Synonyms

psbB; LOC_Osp1g00600; Nip090; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-508

Protein Length

full length protein

Species

Oryza sativa subsp. japonica (Rice)

Target Names

psbB

Target Protein Sequence

MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQPV

Uniprot No.

P0C364

Target Background

Function

CP47, also known as Photosystem II CP47 chlorophyll apoprotein (psbB), is a crucial component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase. Utilizing light energy, it extracts electrons from H₂O, generating O₂ and a proton gradient that subsequently fuels ATP formation.

Database Links

KEGG: osa:3131410

STRING: 39947.LOC_Os06g39708.1

Protein Families

PsbB/PsbC family, PsbB subfamily

Subcellular Location

Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Oryza sativa subsp. japonica Photosystem II CP47 chlorophyll apoprotein (psbB)

Description

Table 1: Key Molecular Features

Functional Role in Photosynthesis

3.1. Biogenesis and Regulation

Table 2: Key Research Studies

3.2. Experimental Applications

Table 4: Expression Systems for Recombinant PsbB

Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service