Recombinant Oryza sativa subsp. japonica Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

The psbD protein consists of 353 amino acids (UniProt ID: P0C437) with a molecular weight of approximately 38 kDa . Its sequence includes transmembrane helices and conserved domains essential for binding chlorophyll and quinones. Key structural features include:

Amino Acid Sequence (Partial)Functional Domain
MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGChloroplast transit peptide
GWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHChlorophyll-binding region
VLGAALLCAIHGATVENTLFEDGDGANTFRAQuinone (Q_A) interaction site

The protein is expressed in E. coli systems with His tags for purification and retains activity in Tris-based buffers with 50% glycerol . Post-translational modifications are not reported in current datasets.

Functional Role in Photosynthesis

As a core PSII subunit, psbD enables:

  • Electron Transfer: Mediates electron transport from water to plastoquinone via the Q_A site .

  • Stress Response: Upregulated under heat stress (HS) in roots and crowns, particularly when acclimation precedes stress .

  • Antioxidant Coordination: Partners with SOD isoforms (e.g., FeSOD, MnSOD) to mitigate oxidative damage during HS .

Knockdown studies demonstrate that psbD dysfunction reduces chlorophyll content and impairs PSII efficiency, as seen in OsLHCB3-silenced rice mutants .

3.1. Photosynthetic Mechanism Studies

  • Used to investigate PSII assembly and electron transport kinetics .

  • Critical for elucidating heat-stress adaptations in rice .

3.2. Transgenic Plant Development

  • Overexpression/knockdown models reveal psbD's role in male sterility and chloroplast stability .

3.3. Biochemical Assays

  • Commercial ELISA kits utilize recombinant psbD for quantifying PSII components in rice .

5.1. Heat Stress Adaptation

  • Acclimation-enhanced SIG5 expression upregulates psbD in roots and crowns under HS, improving PSII resilience .

  • Direct HS-R treatment elevates psbD-linked AOX1a/b/c expression, enhancing mitochondrial-plastid crosstalk .

5.2. Chlorophyll Regulation

  • OsLHCB3 knockdown reduces psbD levels, causing pale leaves and 20–30% lower chlorophyll a/b ratios .

5.3. Evolutionary Conservation

  • PsbD sequences are conserved across Oryza species, including O. nivara and O. sativa Indica/Japonica subgroups .

Challenges and Future Directions

Current limitations include instability during freeze-thaw cycles and incomplete structural resolution. Future studies may focus on:

  • Engineered psbD variants for stress-tolerant rice cultivars.

  • Cryo-EM studies to map Q_A site interactions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbD; LOC_Osp1g00170; Nip018; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
psbD
Target Protein Sequence
MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 plays a crucial role in the assembly of a stable PSII complex.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of PsbD (D2) protein in rice photosynthetic systems?

PsbD, commonly referred to as D2 protein, forms the reaction core of Photosystem II (PSII) as a heterodimer with the D1 protein (PsbA). With a molecular mass of approximately 39.5 kDa, the D2 protein is slightly larger than D1 . Functionally, D2 protein is essential for the proper assembly and stability of the PSII reaction center complex, which facilitates critical photosynthetic processes including water splitting, oxygen evolution, and plastoquinone reduction .

The D2 protein contains multiple transmembrane helices that anchor it within the thylakoid membrane of chloroplasts. Its structural arrangement enables efficient electron transport within the photosynthetic apparatus. The accumulation of functional D2 protein represents a critical step in the biogenesis and assembly of the entire PSII complex .

How does D2 protein interact with other components of the PSII complex?

The D2 protein forms a heterodimeric core with D1 that serves as the foundation upon which the entire PSII complex is assembled. This core complex interacts with numerous other components including:

  • Low-molecular-mass proteins that stabilize the complex

  • Extrinsic oxygen-evolving complex (OEC) proteins that facilitate water splitting

  • Light-harvesting complex II (LHCII) proteins that funnel captured light energy to the reaction center

These interactions create a sophisticated molecular machinery optimized for light harvesting and energy conversion. Recent research indicates that specific assembly factors, such as Psb28 protein, are indispensable for the stable accumulation of PSII core complexes, highlighting the complex interactions required for proper D2 integration and function .

What methods are available for detecting PsbD protein in rice samples?

Several techniques are available for detecting and quantifying PsbD protein:

TechniqueApplicationSensitivityNotes
Western BlottingProtein detection/quantificationHighUses specific antibodies like Anti-PsbD (AS06 146) with global reactivity
ImmunofluorescenceLocalizationModerateReveals spatial distribution in tissue samples
Mass SpectrometryIdentification/quantificationVery highCan detect post-translational modifications
ELISAQuantificationHighSuitable for high-throughput analysis

For Western blotting specifically, researchers should note that D1 and D2 proteins often appear as a single band due to their similar molecular weights, necessitating high-resolution gel systems for proper separation . When analyzing samples with very low PSII content, detection issues may occur regardless of antibody quality, particularly when cells are in stationary phase where PSII content naturally decreases .

How do environmental factors affect D2 protein stability and turnover?

Environmental factors significantly impact D2 protein stability and turnover. High light stress particularly affects the D1-D2 heterodimer, with research showing altered phosphorylation patterns following high light treatment in various mutant backgrounds . This phosphorylation influences protein stability and degradation rates.

Studies examining photomorphogenesis demonstrate that light exposure triggers coordinated expression of photosynthetic proteins, including D2. Analysis of greening etiolated seedlings shows progressive accumulation of PSII core proteins (including D1 and D2) during light exposure, with distinct accumulation patterns over 0-48 hour periods .

The stability of D2 can be assessed through:

  • Chlorophyll fluorescence measurements (Fv/Fm values) that correlate with functional PSII levels

  • Immunoblot analysis using antibodies against D2 protein

  • Real-time PCR assessment of transcript levels that may reflect protein production capacity

What expression systems are optimal for producing recombinant rice PsbD protein?

Different expression systems offer distinct advantages for producing recombinant PsbD protein:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, biotinylation options (AviTag-BirA technology)Limited post-translational modificationsStructural studies, antibody production
YeastBetter post-translational modifications, suitable for membrane proteinsModerate yieldFunctional studies requiring eukaryotic processing
BaculovirusGood for complex proteins, preserves membrane protein structureComplex protocol, moderate costInteraction studies, structural analysis
Mammalian cellOptimal native folding, complete post-translational modificationsHigher cost, lower yieldStudies requiring fully functional protein

For membrane proteins like PsbD, expression systems that facilitate proper membrane integration are crucial. The E. coli system with biotinylation capabilities (using AviTag-BirA technology) offers advantages for detection and purification, as it catalyzes amide linkage between biotin and specific lysine residues of the AviTag peptide .

How do mutations in the psbD gene affect photosynthetic efficiency?

Mutations in the psbD gene can profoundly impact photosynthetic efficiency by altering the structure and function of the D2 protein. Research examining photomorphogenesis in various mutants demonstrates that alterations affecting D2 protein can significantly impact the maximum quantum yields of PSII (Fv/Fm values) .

Specific effects of psbD mutations include:

  • Disrupted electron transport through the PSII reaction center

  • Altered binding of cofactors necessary for light harvesting

  • Compromised assembly of the entire PSII complex

  • Modified interactions with other photosynthetic components

The critical role of D2 protein in forming the reactive core of PSII means that mutations can have cascading effects throughout the photosynthetic apparatus. Studies show that proteins like Psb28 are indispensable for stable accumulation of PSII core complexes, suggesting that mutations affecting D2-Psb28 interactions could significantly impact photosynthetic performance .

How does the D2 protein from japonica subspecies compare to its indica counterpart?

While specific comparative data between japonica and indica D2 proteins is limited in the search results, we can infer important information about their similarities and differences:

The anti-PsbD antibody shows broad reactivity across multiple plant species including Oryza sativa, suggesting high conservation of the D2 protein structure across rice subspecies . This conservation is expected given the fundamental role of D2 in photosynthesis.

Potential differences between japonica and indica D2 proteins might include:

  • Minor amino acid substitutions that may influence protein stability under different environmental conditions

  • Subtle variations in post-translational modification sites

  • Differences in expression regulation that could affect accumulation rates

These subspecies-specific variations may reflect adaptations to different environmental niches occupied by japonica and indica rice varieties. The tropical japonica germplasm lines described in the search results demonstrate genetic variation in other important traits, suggesting that similar variations might exist in photosynthetic proteins including D2 .

What role does D2 protein play in state transitions and photosystem stoichiometry?

D2 protein plays a crucial role in state transitions and photosystem stoichiometry regulation. Research examining thylakoid protein phosphorylation shows that D1 and D2 proteins (often detected together due to similar size) exhibit altered phosphorylation patterns during state transitions .

Specifically, when plants transition from state 1 (balanced excitation) to state 2 (PSII over-excitation), the phosphorylation status of thylakoid proteins changes. Analysis using anti-phosphothreonine antibodies demonstrates that core photosystem II proteins including D1 and D2 undergo phosphorylation changes during these transitions .

Recent research examining S2P2 (the chloroplast-located intramembrane protease) highlights its impact on the stoichiometry and functioning of the photosynthetic apparatus in Arabidopsis, with effects likely extending to D2 protein dynamics . This research indicates that D2 protein is not merely a structural component but actively participates in dynamic processes that optimize photosynthetic efficiency under changing light conditions.

What purification strategies yield highest recovery of functional recombinant PsbD?

Purifying functional recombinant PsbD protein requires specialized approaches due to its hydrophobic nature as a membrane protein. Based on available information, effective purification strategies include:

  • Initial Extraction and Solubilization:

    • Gentle detergent solubilization (e.g., n-dodecyl-β-D-maltoside)

    • Careful buffer optimization to maintain protein stability

    • Inclusion of protease inhibitors to prevent degradation

  • Affinity Chromatography Options:

    • Biotinylation-based purification using the AviTag-BirA system

    • Immobilized metal affinity chromatography with histidine tags

    • Immunoaffinity approaches using anti-PsbD antibodies

  • Additional Purification Steps:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography for further purification

    • Quality assessment via Western blotting with specific antibodies like AS06 146

For proteins produced in E. coli with biotinylation via AviTag-BirA technology, the high specificity of E. coli biotin ligase (BirA) in covalently attaching biotin to the AviTag peptide enables efficient purification using streptavidin-based affinity methods .

How can researchers effectively design experiments to study D2 protein phosphorylation?

Designing experiments to study D2 protein phosphorylation requires careful consideration of multiple factors:

  • Sample Preparation:

    • Isolation of intact thylakoid membranes under conditions that preserve phosphorylation status

    • Rapid extraction in the presence of phosphatase inhibitors

    • Controlled light conditions during sample preparation

  • Analytical Approaches:

    • PhostagTM-pendant acrylamide gels that specifically retard phosphorylated proteins

    • Western blotting with anti-phosphothreonine antibodies to detect phosphorylated D1/D2

    • Mass spectrometry to identify specific phosphorylation sites

  • Experimental Manipulations:

    • Light quality transitions (red/far-red light) to induce state transitions

    • Kinase inhibitor treatments to block phosphorylation

    • Use of appropriate genetic mutants (e.g., stn7/stn8 double mutants as non-phosphorylated controls)

  • Controls and Validations:

    • Including kinase-deficient mutants (e.g., stn7/stn8) as negative controls

    • Time-course analyses to capture dynamic phosphorylation changes

    • Correlation with functional parameters (e.g., variable chlorophyll fluorescence)

The research described in the search results demonstrated successful analysis of phosphorylation states using both PhostagTM-pendant acrylamide gels and anti-phosphothreonine antibodies in various genetic backgrounds, providing methodological guidance for similar studies .

What are the best approaches for studying D2 protein turnover rates?

Studying D2 protein turnover rates requires specialized techniques that can distinguish between protein synthesis and degradation processes:

  • Pulse-Chase Experiments:

    • Metabolic labeling with stable isotopes (e.g., 15N, 13C)

    • Temporal sampling to track labeled protein disappearance

    • Mass spectrometry analysis to quantify labeled vs. unlabeled protein

  • Inhibitor-Based Approaches:

    • Application of translation inhibitors (e.g., lincomycin, chloramphenicol)

    • Western blot analysis at various time points to track protein degradation

    • Quantification of protein half-life in different conditions

  • Fluorescent Protein Fusions:

    • Creation of D2-fluorescent protein fusions (if functional)

    • Live-cell imaging to track protein turnover in real-time

    • Photobleaching techniques to measure protein replacement rates

  • Quantitative Western Blotting:

    • Time-course sampling after various treatments

    • Immunoblotting with D2-specific antibodies (e.g., AS06 146)

    • Normalization to stable reference proteins for accurate quantification

The research described in the search results used immunoblot analysis at different time points during greening of etiolated seedlings, demonstrating progressive accumulation of PSII core proteins including D2 . Similar approaches can be adapted to study turnover rates under various stress conditions.

How should researchers interpret D2 protein expression changes in stress response studies?

Interpreting D2 protein expression changes in stress response studies requires a multifaceted approach:

The research described in the search results shows how D2 protein levels were analyzed during photomorphogenesis, with changes correlated with Fv/Fm values as a functional parameter . Similarly, phosphorylation states were examined after high light treatment, demonstrating how protein modifications correlate with functional transitions .

What computational approaches can predict functional impacts of D2 protein mutations?

Computational approaches offer powerful tools for predicting how mutations in the D2 protein might affect its function:

  • Structural Modeling and Analysis:

    • Homology modeling based on known PSII crystal structures

    • Molecular dynamics simulations to assess structural stability

    • Binding site analysis for cofactor interactions

  • Sequence-Based Predictions:

    • Conservation analysis across species to identify critical residues

    • Evolutionary coupling analysis to detect co-evolving residues

    • Machine learning approaches trained on known mutational effects

  • Energy Calculations:

    • Free energy perturbation calculations for stability predictions

    • Electrostatic analysis for charge distribution effects

    • Hydrogen bonding network analysis for structural integrity assessment

  • Systems Biology Approaches:

    • Protein-protein interaction network analysis

    • Pathway modeling to predict systemic effects

    • Integration with transcriptomic and metabolomic data

These computational approaches can guide experimental design by identifying critical residues most likely to affect function when mutated, potentially saving significant laboratory resources by prioritizing the most promising targets for investigation.

How can CRISPR/Cas9 technology be utilized to study D2 protein function in rice?

CRISPR/Cas9 technology offers unprecedented opportunities for precise genetic manipulation to study D2 protein function:

  • Gene Editing Strategies:

    • Targeted mutations in specific functional domains

    • Creation of truncation variants to identify essential regions

    • Introduction of subtle amino acid substitutions to assess specific residue functions

  • Experimental Approaches:

    • Design of guide RNAs targeting specific regions of the psbD gene

    • Creation of homology-directed repair templates for precise mutations

    • Development of multiplexed editing systems for studying interaction partners

  • Phenotypic Analysis:

    • Assessment of photosynthetic efficiency in edited plants

    • Evaluation of growth and development under various conditions

    • Measurement of stress tolerance and recovery capacity

  • Molecular Characterization:

    • Verification of edits using sequencing

    • Analysis of D2 protein accumulation and modification

    • Assessment of PSII complex assembly and function

When designing CRISPR experiments targeting psbD, researchers should consider the conserved nature of this gene and its essential function in photosynthesis. Subtle mutations or inducible systems may be preferable to complete knockouts, which might be lethal or severely impair plant viability.

What techniques can resolve contradictory findings about D2 protein function?

When faced with contradictory findings about D2 protein function, researchers can employ several methodological approaches to resolve discrepancies:

  • Standardization of Experimental Conditions:

    • Establish consistent growth and treatment protocols

    • Define precise developmental stages for analysis

    • Standardize protein extraction and detection methods

  • Multi-technique Validation:

    • Apply complementary analytical approaches

    • Combine in vitro and in vivo methodologies

    • Utilize both genetic and biochemical techniques

  • Collaborative Cross-laboratory Studies:

    • Perform interlaboratory comparisons with standardized materials

    • Share protocols and materials to ensure reproducibility

    • Conduct blind analyses of samples prepared under identical conditions

  • Meta-analysis Approaches:

    • Systematic review of methodological differences

    • Statistical analysis of effect sizes across studies

    • Identification of variables that explain contradictory results

This methodological framework helps distinguish genuine biological complexity from technical artifacts. For example, observations of D2 protein levels might vary due to differences in antibody specificity, extraction conditions, or developmental timing rather than reflecting true biological differences.

How might advances in cryo-EM technology enhance our understanding of rice D2 protein structure?

Cryo-electron microscopy (cryo-EM) has revolutionized structural biology of membrane protein complexes and offers several advantages for studying rice D2 protein:

Recent advances in cryo-EM technology, including direct electron detectors and improved image processing algorithms, now enable visualization of subtle structural differences that might explain functional variations between different rice varieties or under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.