Recombinant Oryza sativa subsp. japonica Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. japonica Photosystem Q(B) protein is a genetically engineered version of the D1 protein, a critical component of Photosystem II (PSII) in rice chloroplasts. This protein facilitates electron transport during photosynthesis by binding plastoquinone and participating in water oxidation . Produced in E. coli with an N-terminal His tag, it serves as a vital tool for studying PSII structure, herbicide resistance, and photosynthetic mechanisms .

Catalytic Activity

The D1 protein catalyzes the oxidation of water and reduction of plastoquinone:
2H2O+2plastoquinone+4photonsO2+2plastoquinol2 \text{H}_2\text{O} + 2 \text{plastoquinone} + 4 \text{photons} \rightarrow \text{O}_2 + 2 \text{plastoquinol} .

Complex Assembly

  • Forms a heterodimer with the D2 protein, anchoring the P680 chlorophylls and pheophytin cofactors .

  • Binds a non-heme iron and participates in the oxygen-evolving manganese-calcium cluster .

  • Mutations in psbA disrupt chloroplast development and reduce photosynthetic efficiency, as shown in rice mutants with impaired thylakoid membrane protein transport .

Biochemical Studies

  • Herbicide Binding: Used to investigate interactions with herbicides like atrazine and diuron, which block the Q(B) site .

  • Structural Analysis: Purified protein (>90% purity by SDS-PAGE) enables crystallography and mutagenesis studies .

  • Antibody Production: Serves as an antigen for developing antibodies targeting PSII components .

Agricultural Relevance

  • Studies on psbA variants inform strategies for engineering herbicide-resistant rice strains .

  • Downregulation of PSII-related genes (e.g., OsLHCB3) in rice mutants highlights the D1 protein’s role in maintaining photosynthetic efficiency .

Significance in Plant Biology Research

The recombinant D1 protein provides a controlled system to dissect PSII dynamics, from electron transport to stress responses. Its use in structural and functional studies has advanced understanding of photosynthetic efficiency and crop resilience . Future work may leverage this protein to engineer rice varieties with enhanced photosynthetic capacity under environmental stressors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
psbA; Nip001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of the psbA gene in rice?

The psbA gene encodes the Photosystem Q(B) protein (D1 protein), which is essential for photosynthesis in rice. This protein constitutes a core component of Photosystem II, which catalyzes the light-driven water oxidation reaction and reduction of plastoquinone . Mutations or alterations in psbA gene expression can significantly impact photosynthetic efficiency, as evidenced in studies where reduced levels of D1 protein led to decreased photosynthetic capacity .

Research has shown that transcript levels of psbA are tightly regulated in wild-type rice plants, and disruptions to this regulation can affect the assembly and function of the PSII complex . In various photosynthetic mutants, the synthesis of D1 protein can be dramatically reduced to less than 10% of wild-type levels, demonstrating the critical importance of proper psbA expression for plant photosynthesis and growth .

How does the D1 protein interact with other components of Photosystem II?

The D1 protein (Photosystem Q(B) protein) functions as part of a multi-subunit complex within Photosystem II. Research indicates that D1 directly interacts with several other PSII core subunits, including D2, CP47, and CP43, to form the functional reaction center of PSII . These interactions are crucial for maintaining the structural integrity and electron transport capabilities of the photosystem.

Studies using pulse-chase experiments with labeled methionine have revealed that D1 protein assembly into PSII complexes follows a specific sequence, with unassembled or free D1 proteins being detectable prior to their incorporation into the complete PSII structure . The assembly process is less efficient in certain mutants, such as the lpa1 mutant in Arabidopsis, where higher levels of free D1 proteins are observed compared to wild-type plants .

Furthermore, immunoblot analyses have demonstrated that the steady-state levels of D1 protein are often correlated with other PSII core subunits, suggesting coordinated regulation of these components .

What methodological approaches are recommended for optimal expression and purification of recombinant PsbA?

The expression and purification of recombinant Photosystem Q(B) protein (PsbA/D1) requires specific conditions to ensure proper folding and functionality. Based on established protocols, the following methodological approach is recommended:

Expression System:

  • E. coli is the preferred expression system for recombinant PsbA protein

  • BL21(DE3) strain is commonly used with induction at OD600 of 0.6-0.8

  • Induction with 0.5-1.0 mM IPTG at 18-20°C for 16-20 hours yields better results than higher temperature induction

Purification Strategy:

  • Cell lysis using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors

  • Initial purification using Ni-NTA affinity chromatography for His-tagged protein

  • Gradient elution with increasing imidazole concentration (20-250 mM)

  • Secondary purification using size exclusion chromatography

  • Final protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Reconstitution Protocol:
For optimal results, reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage, with 50% being the default concentration used in commercial preparations . Aliquot the reconstituted protein and store at -20°C/-80°C to avoid repeated freeze-thaw cycles.

How do mutations in the psbA gene affect PSII assembly and function in rice?

Mutations in the psbA gene significantly impact PSII assembly and function through multiple mechanisms. Research findings indicate these effects operate at both transcriptional and post-transcriptional levels:

Impact on Protein Synthesis and Turnover:
Mutations affecting psbA can dramatically reduce D1 protein synthesis to less than 10% of wild-type levels while leaving the transcript levels unchanged, suggesting post-transcriptional regulation . Additionally, the turnover rates of D1 and other PSII core subunits (CP47, CP43, D2) are typically higher in mutants, indicating decreased protein stability .

Assembly Efficiency:
Pulse-chase experiments with [35S]Met labeling have demonstrated that PSII assembly is less efficient in mutants, with higher proportions of free D1 and D2 proteins compared to wild-type plants . Two-dimensional blue native/SDS-PAGE analyses reveal the presence of abnormal PSII subcomplexes in mutants, suggesting disrupted assembly pathways .

Phenotypic Effects:
Plants with defective psbA gene function exhibit:

  • Pale leaves and significantly reduced growth (leaf area approximately 75% lower than wild type)

  • High chlorophyll fluorescence phenotype

  • Reduced accumulation of other PSII components, with D1, D2, CP47, and CP43 levels at approximately 20%, 40%, 40%, and 30% of wild-type levels, respectively

These findings indicate that proper psbA gene function is essential not only for D1 protein production but also for the coordinated assembly and stability of the entire PSII complex in rice.

What role does phosphorylation play in regulating Photosystem II function during stress conditions?

Phosphorylation of Photosystem II components, including associated light-harvesting proteins, serves as a crucial regulatory mechanism during stress conditions. Research evidence indicates that phosphorylation plays multiple roles in protecting and modulating PSII function:

Pathogen Response Regulation:
Studies in rice have shown that phosphorylation of light-harvesting complex proteins (such as LHCB5) is specifically induced by pathogen infection (e.g., Magnaporthe oryzae) . This phosphorylation contributes to basal immunity and is associated with enhanced reactive oxygen species (ROS) production and expression of pathogenesis-related genes .

Light-Dependent Regulation:
Phosphorylation of PSII-associated proteins is light-intensity dependent, with optimal induction occurring at 100-200 μmol photons m⁻²s⁻¹, but not below 50 μmol photons m⁻²s⁻¹ . This suggests a regulatory mechanism that balances light energy distribution between photosystems during varying light conditions.

Energy Distribution:
Phosphorylation of light-harvesting complex II (LHCII) proteins, including LHCB5 (CP26), regulates the balance of excitation energy between Photosystem I and Photosystem II . This state transition mechanism helps plants adjust to changing light conditions and prevent photodamage.

These phosphorylation-dependent regulatory mechanisms appear to integrate environmental stress responses with photosynthetic function, providing plants with adaptive strategies during challenging conditions.

How should researchers design experiments to study D1 protein turnover in rice photosystem II?

Designing experiments to study D1 protein turnover requires specialized techniques that can capture the dynamic nature of this process. Based on established research protocols, the following methodological approach is recommended:

Pulse-Chase Labeling Protocol:

  • Isolate intact chloroplasts from rice leaves using a Percoll gradient centrifugation method

  • Perform pulse labeling with [35S]Met in the presence of cycloheximide (which blocks nuclear-encoded protein synthesis) for 20 minutes

  • Chase with unlabeled methionine for various time intervals (0, 30, 60, 120 minutes)

  • Extract thylakoid membrane proteins and analyze by SDS-PAGE and autoradiography

Quantification Method:

  • Use phosphorimaging for quantitative analysis of protein bands

  • Calculate half-life of D1 protein by plotting remaining radioactivity (%) versus chase time

  • Compare turnover rates between wild-type and experimental treatments

Complementary Approaches:

  • Immunoblot analysis using antibodies against D1, D2, CP43, and CP47 to determine steady-state protein levels

  • Blue native gel electrophoresis followed by second-dimension SDS-PAGE to analyze PSII complex assembly and subcomplexes

  • qRT-PCR to monitor psbA transcript levels and rule out transcriptional effects

This multi-faceted approach allows researchers to distinguish between effects on protein synthesis, assembly, and degradation, providing comprehensive insights into D1 protein dynamics under various experimental conditions.

What techniques are most effective for analyzing the interaction between recombinant PsbA and other photosynthetic proteins?

Analyzing interactions between recombinant PsbA (D1) and other photosynthetic proteins requires specialized techniques that can capture both stable and transient protein-protein interactions. Based on current research approaches, the following methods are most effective:

In Vitro Interaction Studies:

  • Co-immunoprecipitation (Co-IP) using antibodies specific to PsbA or interacting partners

  • Pull-down assays with His-tagged recombinant PsbA as bait

  • Surface Plasmon Resonance (SPR) to measure binding kinetics and affinity constants

  • Isothermal Titration Calorimetry (ITC) for thermodynamic analysis of protein interactions

In Vivo Interaction Analysis:

  • Split-GFP complementation assays to visualize protein interactions in planta

  • Förster Resonance Energy Transfer (FRET) using fluorescently tagged proteins

  • Bimolecular Fluorescence Complementation (BiFC) to confirm direct protein interactions in plant cells

Structural Studies:

  • Cross-linking coupled with mass spectrometry to identify interaction interfaces

  • Blue native PAGE followed by second-dimension SDS-PAGE to analyze intact protein complexes and their components

  • Cryo-electron microscopy for structural analysis of PSII complexes containing PsbA

When using recombinant proteins, it's critical to verify that the purified proteins maintain their native conformation. Circular dichroism spectroscopy can be used to confirm secondary structure integrity before interaction studies. Additionally, functional assays such as oxygen evolution measurements should be performed to verify that recombinant PsbA retains its activity when reconstituted with other PSII components.

How can researchers effectively study the impact of environmental stressors on PsbA gene expression and protein accumulation?

Studying the impact of environmental stressors on PsbA gene expression and protein accumulation requires an integrated approach combining molecular, biochemical, and physiological techniques. Based on established research strategies, the following comprehensive experimental design is recommended:

Transcriptional Analysis:

  • qRT-PCR to quantify psbA transcript levels under various stress conditions (e.g., high light, drought, temperature extremes, pathogen infection)

  • Run-on transcription assays with isolated chloroplasts to determine transcription rates

  • RNA gel blot analysis to assess transcript stability and processing

Translational and Post-translational Analysis:

  • Polysome profiling to determine translation efficiency of psbA mRNA

  • In vivo protein labeling with [35S]Met in the presence of cycloheximide to measure de novo synthesis rates

  • Pulse-chase experiments to determine protein turnover rates under stress conditions

  • Phos-tag gel electrophoresis to detect phosphorylation changes in response to stress, as phosphorylation has been shown to regulate PSII function

Protein Accumulation Analysis:

  • Immunoblot analysis using antibodies against PsbA/D1 protein to quantify steady-state levels

  • Blue native PAGE followed by immunoblotting to analyze PSII complex assembly under stress

  • Confocal microscopy with fluorescently tagged PsbA to track localization changes

Physiological Measurements:

  • Chlorophyll fluorescence to assess PSII function (Fv/Fm, NPQ, ΦPSII)

  • Oxygen evolution measurements to determine PSII activity

  • Reactive oxygen species (ROS) detection using specific dyes (e.g., DAB staining)

Experimental Design Considerations:

  • Include appropriate time-course analysis to capture both early and late stress responses

  • Use multiple stress intensities to establish dose-response relationships

  • Implement both abrupt and gradual stress applications to distinguish between shock and acclimation responses

  • Include recovery phases to assess repair mechanisms

This multifaceted approach allows researchers to distinguish between transcriptional, translational, and post-translational effects of environmental stressors on PsbA, providing comprehensive insights into stress adaptation mechanisms in rice photosynthesis.

How should researchers interpret contradictory results between transcript levels and protein accumulation of the psbA gene?

When researchers encounter discrepancies between psbA transcript levels and D1 protein accumulation, systematic analysis is required to identify the regulatory mechanisms involved. Published research has documented such contradictions, providing a framework for interpretation:

Common Discrepancy Pattern:
Studies have shown that psbA transcript levels may remain unchanged while D1 protein accumulation is significantly reduced (to ~20% of wild-type levels) in certain mutants . This pattern indicates regulation occurs primarily at post-transcriptional levels.

Interpretation Framework:

Level of RegulationAnalytical ApproachInterpretation of Discrepancy
TranscriptionalRNA gel blot, qRT-PCRIf transcript levels are normal but protein is reduced, transcription is likely not the limiting factor
TranslationalPolysome profiling, in vivo labelingReduced [35S]Met incorporation into D1 despite normal transcript levels indicates translational regulation
Post-translationalPulse-chase experimentsAccelerated decline in labeled D1 during chase period indicates increased turnover/degradation
AssemblyBlue native/SDS-PAGEHigher levels of free D1 protein versus assembled complexes suggests assembly defects

Methodological Considerations:

  • Confirm antibody specificity in immunoblot analyses

  • Verify sample preparation does not introduce artifacts that affect either transcript or protein detection

  • Use multiple time points to capture dynamic changes in both transcript and protein levels

Biological Implications:
Discrepancies between transcript and protein levels often reveal important regulatory mechanisms. For example, in the lpa1 mutant, normal psbA transcript levels combined with reduced D1 protein synthesis and accelerated turnover indicated that LPA1 functions primarily in translation and/or assembly of the D1 protein rather than in transcriptional regulation .

What insights can be gained from comparative analysis of wild-type and chlorophyll b-lacking rice regarding Photosystem II function?

Comparative analysis of wild-type and chlorophyll b-lacking rice mutants provides valuable insights into the relationship between pigment composition and Photosystem II function. Research findings reveal several key aspects of this relationship:

Structural Alterations:
Chlorophyll b-lacking rice exhibits distinct plastid ultrastructural changes, including:

Transcriptional Reprogramming:
Transcriptome profiling reveals specific adjustments in photosynthetic gene expression:

  • Downregulation of PsbR (PSII core protein) gene expression

  • Downregulation of GluTR gene involved in chlorophyll biosynthesis

  • Upregulation of UROD, CPOX, and MgCH genes in the tetrapyrrole pathway

  • Upregulation of NOL genes that regulate chlorophyll b degradation

Functional Consequences:
These molecular and structural changes result in:

Interpretative Framework:
The data suggest a compensatory response where the plant attempts to maintain photosynthetic function despite chlorophyll b deficiency through:

  • Adjusting the stoichiometry of photosynthetic components

  • Modifying tetrapyrrole metabolism

  • Enhancing conversion pathways between chlorophyll forms

These insights highlight the plasticity of the photosynthetic apparatus and demonstrate how plants can adapt to pigment composition changes through coordinated adjustments in gene expression, protein accumulation, and metabolic pathways.

How does phosphorylation status of light-harvesting proteins affect interpretation of PsbA function during stress responses?

The phosphorylation status of light-harvesting proteins significantly impacts the interpretation of PsbA/D1 function during stress responses. Research findings provide a nuanced framework for understanding this regulatory relationship:

Integration of Phosphorylation and Stress Response Signals:
Studies have shown that phosphorylation of light-harvesting complex proteins (like LHCB5) is specifically induced under certain stress conditions, such as pathogen infection with Magnaporthe oryzae . This phosphorylation is light-dependent, occurring optimally at light intensities of 100-200 μmol photons m⁻²s⁻¹ .

Functional Consequences of Phosphorylation:
When interpreting PsbA/D1 function, researchers must consider that:

  • Phosphorylation of light-harvesting proteins alters excitation energy distribution between PSI and PSII, which affects electron transport through the D1 protein

  • Phosphorylation-induced changes in PSII-LHCII interactions can modify D1 protein turnover rates and repair mechanisms

  • Stress-induced phosphorylation contributes to ROS production and immune responses that may indirectly impact D1 function

Experimental Approach for Integrated Analysis:

Analytical MethodParameter MeasuredInterpretation Guidance
Mn²⁺-Phos-tag gel electrophoresisPhosphorylation status of LHCII proteinsChanges in phosphorylation indicate state transitions that affect PSII function
Luminol-based chemiluminescenceROS generationEnhanced ROS production following phosphorylation may increase D1 turnover
qRT-PCRExpression of PR genes and NADPH oxidasesUpregulation correlates with phosphorylation and may affect redox balance around PSII
Immunoblot analysisD1 protein levelsShould be interpreted in context of phosphorylation status of associated proteins

Integrated Interpretation Framework:
When analyzing PsbA/D1 function during stress:

  • First assess phosphorylation status of associated light-harvesting proteins

  • Determine if observed changes in D1 turnover or activity are direct stress effects or secondary consequences of phosphorylation-induced state transitions

  • Consider that stress responses may operate through parallel pathways that independently affect both phosphorylation status and D1 function

This integrated approach allows researchers to distinguish between direct effects on the D1 protein itself and indirect effects mediated through phosphorylation-dependent reorganization of the photosynthetic apparatus during stress responses.

What are the optimal storage and handling conditions for recombinant PsbA protein to maintain its structural integrity?

Maintaining the structural integrity of recombinant PsbA (D1) protein requires specific storage and handling conditions due to its membrane protein nature. Based on established protocols, the following guidelines are recommended:

Storage Conditions:

  • Store lyophilized protein at -20°C to -80°C

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For extended storage, add glycerol to a final concentration of 50% and store at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles, as this significantly reduces protein stability

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

  • Prepare small aliquots to minimize freeze-thaw cycles

Handling Precautions:

  • Maintain protein samples on ice during experiments

  • Avoid exposure to strong light which may cause photodamage

  • Use low-binding microcentrifuge tubes to prevent protein adherence to tube walls

  • Include appropriate protease inhibitors in working solutions

Stability Verification:

  • Periodic SDS-PAGE analysis to confirm protein integrity

  • Functional assays (if applicable) to verify activity maintenance

  • Consider circular dichroism spectroscopy to monitor secondary structure changes during storage

Adherence to these storage and handling guidelines is essential for maintaining the structural and functional integrity of recombinant PsbA protein for research applications.

What methodological considerations are important when using recombinant PsbA in protein-protein interaction studies?

When using recombinant PsbA/D1 protein in protein-protein interaction studies, several methodological considerations are critical to ensure valid and reproducible results:

Protein Preparation Considerations:

  • Protein Folding: As a membrane protein, PsbA requires special attention to maintain proper folding. Consider using membrane-mimetic environments such as detergent micelles (DDM or β-OG) or nanodiscs during purification and interaction studies .

  • Tag Interference: The N-terminal His tag commonly used for purification may potentially interfere with certain protein interactions. Control experiments with tag-cleaved protein or alternatively tagged constructs should be performed .

  • Purity Assessment: Ensure >90% purity by SDS-PAGE before interaction studies to minimize non-specific interactions .

Interaction Assay Considerations:

  • Buffer Composition: Optimize buffer conditions (pH, ionic strength, detergent concentration) to maintain PsbA stability while allowing native interactions.

  • Concentration Effects: Use concentration ranges that reflect physiological conditions; excessive concentrations may lead to non-specific aggregation.

  • Control Experiments: Include appropriate negative controls (unrelated proteins) and positive controls (known interacting partners) in each experiment.

Validation Approaches:

  • Orthogonal Methods: Confirm interactions using multiple techniques (e.g., pull-down assays, SPR, ITC) to increase confidence in results.

  • Competition Assays: Perform competition experiments with unlabeled proteins to verify specificity of interactions.

  • Mutational Analysis: Create site-directed mutants of key residues to map interaction interfaces.

Specific Technical Adaptations for D1 Protein:

  • Light Sensitivity: Conduct experiments under controlled light conditions, as light exposure may alter D1 conformation or induce damage.

  • Redox Sensitivity: Consider the redox state of D1 protein, as it may affect interaction properties; include appropriate redox agents in buffers if necessary.

  • Structural Context: Remember that in vivo, D1 functions within the PSII complex; some interactions may require the presence of additional PSII components.

By carefully considering these methodological aspects, researchers can enhance the reliability and biological relevance of protein-protein interaction studies involving recombinant PsbA/D1 protein.

What are the recommended approaches for studying post-translational modifications of the PsbA protein, particularly phosphorylation?

Studying post-translational modifications (PTMs) of PsbA/D1 protein, particularly phosphorylation, requires specialized techniques that can detect and characterize these modifications with high sensitivity and specificity. The following approaches are recommended based on current research methodologies:

Detection and Characterization Methods:

  • Mn²⁺-Phos-tag Gel Electrophoresis:

    • Particularly effective for detecting phosphorylated forms of proteins

    • Can separate phosphorylated from non-phosphorylated PsbA protein

    • Has been successfully applied to study light-harvesting complex protein phosphorylation in rice

  • Mass Spectrometry-Based Approaches:

    • Tandem MS (MS/MS) for identification of specific phosphorylation sites

    • Multiple Reaction Monitoring (MRM) for quantitative analysis of phosphorylation stoichiometry

    • Phosphopeptide enrichment using TiO₂ or IMAC prior to MS analysis to enhance detection sensitivity

  • Immunological Methods:

    • Phospho-specific antibodies (if available for PsbA phosphorylation sites)

    • Phospho-threonine/serine/tyrosine antibodies combined with immunoprecipitation

    • Pro-Q Diamond phosphoprotein staining for gel-based detection

Experimental Design Considerations:

  • Environmental Conditions:

    • Study phosphorylation under varying light intensities (50-200 μmol photons m⁻²s⁻¹) as phosphorylation has been shown to be light-dependent

    • Include stress conditions such as pathogen exposure as these can induce specific phosphorylation events

    • Consider diurnal variations in phosphorylation status

  • Sample Preparation:

    • Rapid tissue harvesting and protein extraction in the presence of phosphatase inhibitors

    • Membrane protein-specific extraction methods to effectively isolate PsbA

    • Subcellular fractionation to analyze phosphorylation in thylakoid membranes specifically

  • Functional Correlation:

    • Combine phosphorylation analysis with measurements of PSII activity (oxygen evolution, chlorophyll fluorescence)

    • Correlate phosphorylation status with D1 turnover rates using pulse-chase experiments

    • Assess relationship between phosphorylation and interaction with other PSII components

Kinase and Phosphatase Identification:

  • Inhibitor Studies:

    • Use specific kinase/phosphatase inhibitors to identify enzymes responsible for PsbA phosphorylation/dephosphorylation

    • Combine with genetically modified plants lacking specific kinases/phosphatases

  • In Vitro Reconstitution:

    • Perform in vitro kinase assays with recombinant PsbA and candidate kinases

    • Analyze dephosphorylation using purified phosphatases

By integrating these approaches, researchers can comprehensively characterize the phosphorylation status of PsbA/D1 protein and understand its functional significance in photosynthetic regulation under various environmental conditions.

What are the emerging areas of research regarding the role of PsbA/D1 protein in stress adaptation mechanisms?

Research on PsbA/D1 protein's role in stress adaptation is evolving rapidly, with several emerging areas showing particular promise for advancing our understanding of photosynthetic resilience in rice and other crop plants:

Integration of Immune and Photosynthetic Responses:
Recent discoveries indicate unexpected connections between photosynthetic proteins and immune responses. The finding that light-harvesting complex proteins undergo phosphorylation during pathogen infection (e.g., Magnaporthe oryzae) suggests that PSII components, including D1, may play dual roles in both photosynthesis and defense signaling . This emerging field explores how photosynthetic machinery participates in broader stress signaling networks beyond its primary function.

Redox-Based Regulation Networks:
The role of D1 protein in mediating redox signaling during stress is gaining attention. Research suggests that the D1 protein's high turnover rate makes it an ideal sensor for environmental perturbations. Emerging studies are investigating how specific redox modifications of D1 may serve as signals that trigger broader cellular responses to various stresses .

D1 Protein Variants and Climate Resilience:
An emerging area of interest is exploring natural variation in psbA genes across rice ecotypes adapted to different environments. Some research suggests that subtle sequence variations in the D1 protein may contribute to differential stress tolerance. Future research directions include:

  • Cataloging D1 protein variants across rice germplasm

  • Correlating specific D1 variants with enhanced stress tolerance

  • Engineering D1 protein modifications to improve climate resilience

Novel Post-Translational Modifications:
Beyond phosphorylation, other post-translational modifications of D1 protein are being discovered. These include oxidative modifications, ubiquitination, and potentially SUMOylation. Characterizing these modifications and their functional consequences represents an important frontier in understanding D1 protein regulation during stress adaptation.

These emerging research areas highlight the evolving view of D1 protein not merely as a structural component of PSII but as a key player in integrating environmental signals and coordinating adaptive responses in rice and other crops.

How might CRISPR-Cas9 gene editing be applied to study PsbA function in rice photosynthesis?

CRISPR-Cas9 gene editing offers unprecedented opportunities for precise manipulation of the psbA gene to study D1 protein function in rice photosynthesis. Several strategic approaches are particularly promising:

Domain-Specific Mutagenesis:
The D1 protein contains several functional domains critical for PSII operation. CRISPR-Cas9 can be used to create precise amino acid substitutions to:

  • Modify the QB binding pocket to alter herbicide resistance or electron transport properties

  • Alter residues involved in the water-splitting mechanism

  • Modify transmembrane helices to study assembly requirements

  • Create phosphorylation site mutants to study regulatory mechanisms suggested by recent research

This approach overcomes limitations of traditional mutagenesis by enabling targeted modifications with minimal off-target effects.

Promoter Engineering:
CRISPR-based promoter editing can be used to:

  • Create conditional expression systems to study D1 protein turnover dynamics

  • Generate tissue-specific expression patterns to examine spatial requirements

  • Implement light-responsive elements to investigate circadian regulation

Base Editing Applications:
CRISPR base editors, which can make precise C→T or A→G conversions without double-strand breaks, are ideal for:

  • Creating specific codon changes with minimal disruption

  • Introducing silent mutations to study mRNA stability and translation efficiency

  • Modifying potential regulatory sequences without altering coding regions

Prime Editing Strategies:
The newer prime editing technology allows even more precise edits and can be used to:

  • Insert small protein tags for in vivo tracking

  • Create specific splice variants to study alternative processing

  • Introduce defined deletions to study domain functions

Experimental Design Recommendations:

  • Target multiple sites simultaneously to study epistatic interactions between different D1 domains

  • Create allelic series (multiple variants with increasing severity) to identify critical thresholds for function

  • Combine with fluorescent reporters to track protein localization and turnover in vivo

  • Implement inducible CRISPR systems to study essential gene functions that might otherwise be lethal

Technical Considerations:

  • Use rice-optimized Cas9 variants for improved efficiency

  • Consider ribonucleoprotein (RNP) delivery to minimize off-target effects

  • Implement appropriate screening strategies for chloroplast-encoded genes

  • Design complementation strategies to verify phenotype-genotype relationships

These CRISPR-based approaches will enable unprecedented insights into D1 protein function, potentially leading to rice varieties with enhanced photosynthetic efficiency and stress tolerance.

What are the potential applications of recombinant PsbA protein in developing improved photosynthetic efficiency in crop plants?

Recombinant PsbA/D1 protein offers several promising applications for enhancing photosynthetic efficiency in rice and other crop plants through both fundamental research and applied biotechnology approaches:

Structure-Function Relationship Elucidation:
Recombinant PsbA protein enables detailed structural and biochemical studies that can inform targeted engineering efforts:

  • In vitro reconstitution experiments to identify rate-limiting steps in PSII assembly

  • Biophysical characterization to determine electron transfer kinetics of variant D1 proteins

  • Crystallography studies using recombinant protein to resolve structural details relevant to function

These fundamental insights can guide rational design of improved D1 variants.

Directed Evolution Platforms:
Recombinant expression systems allow for:

  • High-throughput screening of D1 variants with enhanced properties

  • Selection under specific stress conditions (high light, temperature extremes, ROS)

  • Identification of variants with improved turnover characteristics or reduced photoinhibition

Engineering Approaches for Crop Improvement:
Based on insights from recombinant protein studies, several engineering strategies show promise:

Engineering StrategyMechanismExpected Benefit
D1 variants with modified QB binding sitesAltered electron transport kineticsReduced photoinhibition under fluctuating light
Enhanced repair cycle efficiencyOptimized D1 turnoverImproved recovery from high light stress
Phosphorylation site modificationsAltered regulatory propertiesBetter adaptation to environmental fluctuations
Redox-insensitive variantsReduced susceptibility to ROS damageImproved performance under stress conditions

Biotechnological Applications:

  • Development of D1-based biosensors for monitoring environmental stressors

  • Creation of diagnostic tools for assessing photosynthetic efficiency in the field

  • Production of antibodies against specific D1 epitopes for research applications

Translation to Crop Improvement:
While direct transformation with engineered psbA genes presents challenges due to chloroplast transformation limitations in many species, several approaches show promise:

  • Plastid transformation in amenable crops

  • CRISPR-directed base editing of endogenous psbA

  • Engineering of nuclear-encoded factors that influence D1 synthesis, assembly, or turnover based on insights from recombinant protein studies

The application of knowledge gained from recombinant PsbA research could contribute to developing climate-resilient crops with enhanced photosynthetic efficiency, ultimately addressing food security challenges in a changing environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.