Recombinant Oryza sativa subsp. japonica Potassium channel KAT2 (Os01g0210700, LOC_Os01g11250)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

KAT2 functions as an inward-rectifying potassium channel, activated by hyperpolarization . Key roles include:

  • Ion Selectivity: Mediates potassium uptake while excluding sodium ions, critical for maintaining cellular ion balance .

  • Voltage Sensitivity: Structural rearrangements in the S4 domain regulate channel gating in response to membrane potential changes .

  • Physiological Impact: Contributes to root and shoot ion homeostasis, potentially influencing stress responses in rice .

Research Applications

Recombinant KAT2 is widely used in:

  1. Functional Studies: Electrophysiological assays to characterize voltage-dependent gating and ion selectivity .

  2. Stress Response Analysis: Investigating K⁺ transport under salinity or drought conditions .

  3. Structural Biology: Crystallization trials to resolve pore architecture and regulatory domains .

Evolutionary and Comparative Insights

KAT2 homologs in Arabidopsis (e.g., AKT1) share functional similarities, but rice-specific isoforms like KAT2 exhibit unique regulatory features, such as calcium sensitivity via EF-hand domains . Phylogenetic analysis places KAT2 within the Shaker family’s inwardly rectifying clade, distinct from outward-rectifying channels like SKOR .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your desired tag.
Synonyms
Os01g0210700; LOC_Os01g11250; P0031E09.16; P0466B10.26; Potassium channel KAT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0210700
Target Protein Sequence
METISNIFHNDPLPPLGARANQSIKLRKFIISPYDSRYRTWETFLLVLVVYSAWICPFEL AYLRNLSWKVSLVDNIIDSFFAIDIILTFFLAYLDQKSYLLVDDPKRIVARYFSSWFLFD VCSTIPYQLLGQIFKKHENGLAYRLLSMLRLWRLRRLSELFARLEKDIRLNYYWIRCTKL ISVTLFAVHCSGCFNYLIADRYPNPARTWIGAAIPNYRSQNLWVRYVTAIYWSITTLTTT GYGDLHAENQREMLFSICYMLFNLGLTAYLIGNMTNLVVQGSCRTRNFRDTIHAASQFAA RNQLPGHIKDEMLSHICLRYKTEGLKQKETLDSLPKGIRSSIACNLFLPVIEKVYLFHGV SFTCMIQLVTEMEAEYYPPREVVILQNEAPRDVYILVSGAVEERVEIDGTEKVQEVLCNG EIFGEIGVICSIPQPCAFHTIKVSQLLRLNTAVLKNIIKENSDDRRVILNNLSQKMNQDH RFSTEVMEKSLQMMHQHFGEYNRCSALNQDNEKNELKANNGHSMALEWKRVTIHMYSQRN KRPEAPLAKVINLPGSLDKLFAIACQKFNNYRLTKLVNPEFAEIDDITVIRDGDHLFFME I
Uniprot No.

Target Background

Function
This protein is a probable inward-rectifying potassium channel. It is likely to adopt open or closed conformations in response to the voltage difference across the membrane, and its activity is activated by hyperpolarization.
Database Links

KEGG: osa:4325560

UniGene: Os.38354

Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of the KAT2 potassium channel in Oryza sativa?

The KAT2 potassium channel in Oryza sativa subsp. japonica is encoded by gene Os01g0210700 (LOC_Os01g11250), located on chromosome 1. Based on genome-wide analysis, this gene is part of the potassium channel family expressed in rice . The gene has been identified as a fragment in some analyses, suggesting possible alternative splicing events or incomplete annotation. Comprehensive genome analysis of rice has revealed that potassium channels belong to a larger family of membrane proteins that play crucial roles in ion homeostasis and stress responses .

Methodology note: Researchers typically use genome browsers like TIGR or RAP-DB to examine the gene structure, including exon-intron boundaries, promoter regions, and conserved domains. For structural confirmation, full-length cDNA cloning followed by sequencing provides the most accurate gene structure information.

How does the KAT2 potassium channel respond to salt stress in rice?

Under salt stress conditions, the KAT2 potassium channel (Os01g0210700) shows significant downregulation with a fold score of -2.08 and a q-value of 4.88% . This indicates that salt stress negatively impacts the expression of this potassium channel. The downregulation suggests that the KAT2 channel may play a role in the plant's adaptive response to salinity, potentially by regulating K+ homeostasis under stress conditions.

Salt stress significantly affects ion homeostasis in rice, with potassium channels being crucial components in maintaining appropriate K+/Na+ ratios. As demonstrated in gene expression studies, several potassium transport-related genes show differential expression patterns under salt stress, forming part of a complex regulatory network for ion balance .

What is the relationship between KAT2 and other potassium channels in rice?

The rice genome contains multiple potassium channel genes that function in various tissues and respond differently to environmental stimuli. Genome-wide analysis has identified several potassium channel genes in rice, including those encoding K+ channel proteins, two-pore K+ channels, and K+ transporters . The KAT2 channel (Os01g0210700) belongs to the voltage-gated potassium channel family and shows sequence similarity to other members.

Within the broader context of potassium transport systems in rice, the following related genes have been identified:

Gene IDAnnotationResponse to Salt StressFold Scoreq-value (%)
Os01g0210700Potassium channel (Fragment)Downregulated-2.084.88
Os01g0648000Potassium channelUpregulated2.641.36
Os01g0696100K+ channel, two pore family proteinUpregulated2.331.79
Os01g0932500K+ potassium transporter family proteinUpregulated2.651.36
Os03g0337500K+ potassium transporter family proteinDownregulated-3.570.71

These differential expression patterns suggest specialized roles for different potassium channels and transporters in response to salt stress .

How does post-translational modification affect KAT2 channel activity during stress responses?

Post-translational modifications (PTMs) of KAT2 and other potassium channels represent a critical regulatory mechanism affecting channel activity, particularly during stress responses. While specific PTMs of rice KAT2 are not directly reported in the search results, research on plant ion channels suggests several potential modifications:

Phosphorylation: Various protein kinases, including mitogen-activated protein kinases (MAPKs), have been implicated in stress responses in rice. Under salt stress, several MAPK genes show differential expression, including Os01g0665200 (blast and wounding induced MAPK), Os06g0699400 (MAP kinase 2), and Os06g0154500 (MAP kinase 6) . These kinases potentially regulate KAT2 activity through phosphorylation.

Methodology for investigating PTMs:

  • Recombinant expression of KAT2 with epitope tags

  • Immunoprecipitation followed by mass spectrometry

  • Site-directed mutagenesis of putative modification sites

  • Patch-clamp electrophysiology to assess functional changes

  • Phospho-specific antibodies to detect modification states

What is the membrane topology and structure-function relationship of the KAT2 channel?

Understanding the membrane topology and structure-function relationship of KAT2 requires detailed structural analysis and functional characterization. Although the search results don't provide specific structural information about KAT2, research on potassium channels suggests a tetrameric structure with each subunit containing six transmembrane segments (S1-S6) and a pore-forming region.

The functional domains likely include:

  • Voltage-sensing domain (S1-S4)

  • Pore domain (S5-P-S6)

  • Cytoplasmic domains involved in gating

  • Potential interaction sites with regulatory proteins

Methodological approaches for structural studies:

  • Hydropathy plot analysis to predict transmembrane segments

  • Homology modeling based on crystallized potassium channels

  • Cysteine-scanning mutagenesis to map accessible residues

  • Electrophysiological characterization of mutations

  • X-ray crystallography or cryo-EM for 3D structure determination (challenging for membrane proteins)

How does the interaction between KAT2 and other membrane proteins affect ion homeostasis under salt stress?

Potential interacting partners based on salt stress-responsive genes include:

  • Sodium transporters: Na+/H+ exchangers (Os01g0557500, Os09g0286400, Os11g0648000, Os12g0641100)

  • Other potassium transporters: K+ transporters (Os01g0369300, Os06g0625900, Os06g0671000)

  • Calcium transporters: Ca2+ channels (Os01g0678500), Ca2+/H+ exchangers (Os05g0594200)

  • Chloride channels: Voltage-gated Cl- channels (Os02g0720700)

  • Aquaporins and other membrane intrinsic proteins: (Os09g0541000, Os01g0975900, Os05g0231700)

The study of protein-protein interactions requires specialized techniques:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation

  • Förster resonance energy transfer (FRET)

  • Split-ubiquitin membrane-based yeast two-hybrid

What are the optimal expression systems for producing functional recombinant KAT2 channels?

Producing functional recombinant KAT2 channels requires careful selection of expression systems that can properly fold and process plant membrane proteins. Each system has advantages and limitations:

  • Xenopus laevis oocytes:

    • Advantages: Well-established for electrophysiological studies of ion channels

    • Protocol: Inject in vitro synthesized cRNA encoding KAT2

    • Analysis: Two-electrode voltage clamp for functional characterization

    • Considerations: Limited protein yield, but excellent for functional studies

  • Mammalian cell lines (HEK293, CHO):

    • Advantages: Proper protein folding and trafficking

    • Protocol: Transfection with KAT2 expression vectors

    • Analysis: Patch-clamp electrophysiology, fluorescence imaging

    • Considerations: Higher cost, but good for studying regulatory mechanisms

  • Yeast expression systems:

    • Advantages: Eukaryotic processing, higher yield than mammalian cells

    • Protocol: Transformation with KAT2 in yeast expression vectors

    • Analysis: Complementation assays, membrane preparation for reconstitution

    • Considerations: Some plant proteins may not function properly

  • Plant expression systems:

    • Advantages: Native environment for plant proteins

    • Protocol: Agrobacterium-mediated transformation of Arabidopsis, tobacco, or rice

    • Analysis: Electrophysiology, phenotypic analysis, subcellular localization

    • Considerations: Slower process but physiologically relevant

How can electrophysiological techniques be optimized for characterizing KAT2 channel kinetics?

Electrophysiological characterization of KAT2 channels requires specialized techniques to assess channel kinetics, conductance, ion selectivity, and regulation.

Patch-clamp protocols for KAT2 characterization:

  • Whole-cell recordings:

    • Holding potential: -70 mV

    • Test potentials: -120 to +60 mV in 20 mV increments

    • Pulse duration: 500 ms

    • Interpulse interval: 5-10 seconds

    • External solution: 100 mM KCl, 1 mM CaCl₂, 1 mM MgCl₂, 10 mM HEPES (pH 7.4)

    • Internal solution: 150 mM KCl, 1 mM EGTA, 10 mM HEPES (pH 7.2)

  • Single-channel recordings:

    • Cell-attached or inside-out configurations

    • Analysis of open probability, conductance, and gating kinetics

    • Bath and pipette solutions with varying K⁺/Na⁺ ratios to determine selectivity

  • Ion selectivity measurements:

    • Bi-ionic conditions with varying external cations

    • Measurement of reversal potential shifts

    • Calculation of permeability ratios using the Goldman-Hodgkin-Katz equation

  • Modulation studies:

    • Effect of pH, Ca²⁺, membrane tension

    • Response to regulatory molecules (e.g., ATP, cAMP)

    • Analysis of phosphorylation effects using kinase activators/inhibitors

What genetic transformation approaches are most effective for studying KAT2 function in planta?

Genetic manipulation approaches for studying KAT2 function in rice include both loss-of-function and gain-of-function strategies:

  • CRISPR/Cas9 gene editing:

    • Target selection: Design sgRNAs targeting exons of Os01g0210700

    • Vector construction: Cloning sgRNAs into rice-optimized Cas9 vectors

    • Transformation: Agrobacterium-mediated transformation of rice calli

    • Screening: PCR-based genotyping and sequencing

    • Advantages: Precise targeted mutations, possibility of multiplex editing

  • RNAi-mediated knockdown:

    • Design: Creation of hairpin constructs targeting KAT2 mRNA

    • Vector: Gateway cloning into plant RNAi vectors

    • Validation: qRT-PCR to confirm knockdown efficiency

    • Advantages: Can target gene families with similar sequences

  • Overexpression and fluorescent tagging:

    • Promoters: Strong constitutive (OsActin, CaMV 35S) or tissue-specific promoters

    • Tags: C- or N-terminal GFP/YFP for localization studies

    • Considerations: Potential artifacts from overexpression

    • Advantages: Visualization of protein localization and trafficking

  • Complementation studies:

    • Expression of rice KAT2 in Arabidopsis kat2 mutants

    • Cross-species functional verification

    • Analysis of phenotypic rescue

How should transcriptomic data for KAT2 be normalized and analyzed in salt stress experiments?

Analysis of transcriptomic data for KAT2 in salt stress experiments requires rigorous normalization and statistical approaches to generate reliable results:

  • Data normalization methods:

    • RPKM/FPKM for RNA-seq data

    • Quantile normalization for microarray data

    • Use of stable reference genes (e.g., OsUBQ, OsACT, OsEF-1α)

    • Consideration of tissue-specific expression patterns

  • Statistical analysis framework:

    • Modified Significance Analysis of Microarrays (SAM) as used in the referenced studies

    • Determination of fold-change thresholds (typically |FC| > 2)

    • Multiple testing correction (q-value < 5%)

    • Time-course analysis for temporal expression patterns

  • Visualization and interpretation:

    • Heat maps for comparing expression across conditions

    • Principal component analysis for pattern identification

    • Co-expression network analysis to identify functionally related genes

Example of expression data analysis from salt stress studies:

Gene IDControl (FPKM)Salt Stress (FPKM)Fold Changeq-value (%)Expression Pattern
Os01g021070045.621.9-2.084.88Downregulated
Os01g064800018.248.02.641.36Upregulated
Os03g033750032.19.0-3.570.71Downregulated

These patterns indicate differential regulation of potassium transport systems during salt stress, with KAT2 showing significant downregulation .

What protein-protein interaction network analyses reveal the functional context of KAT2?

Protein-protein interaction (PPI) network analysis places KAT2 within a broader functional context of cellular signaling and ion homeostasis. While specific PPI data for rice KAT2 is not provided in the search results, general approaches and predicted interactions can be outlined:

  • PPI prediction methods:

    • Homology-based inference from known interactors in Arabidopsis

    • Co-expression analysis to identify functionally related genes

    • Domain-based interaction prediction

    • Text mining of scientific literature

  • Predicted interaction network components:

    • Regulatory kinases: MAPKs (Os01g0665200, Os06g0699400, Os05g0576800)

    • Calcium sensors: Calmodulins, CDPKs

    • Other ion channels: Cyclic nucleotide-gated channels (Os02g0255000, Os03g0758300)

    • Membrane trafficking proteins: SNARE proteins, vesicle-associated proteins (Os12g0639800)

  • Network analysis tools:

    • Cytoscape for visualization and analysis

    • STRING database for predicted functional associations

    • Gene Ontology enrichment to identify biological processes

  • Experimental validation methods:

    • Co-immunoprecipitation with tagged KAT2

    • Mass spectrometry of immunoprecipitated complexes

    • Bimolecular fluorescence complementation for specific interactions

How can contradictory data on KAT2 expression and function be reconciled?

Contradictory data regarding KAT2 expression and function can arise from differences in experimental conditions, genetic backgrounds, developmental stages, and analytical methods. A systematic approach to reconciling such contradictions includes:

  • Sources of experimental variation:

    • Rice varieties/cultivars: Japonica vs. Indica subspecies

    • Developmental stages: Seedling vs. mature plants

    • Stress conditions: Duration, intensity, combinatorial stresses

    • Tissue specificity: Root vs. shoot expression patterns

  • Methodological considerations:

    • RNA extraction methods affecting transcript detection

    • Primer design for qRT-PCR affecting specificity

    • Antibody specificity for protein detection

    • Normalization methods for expression analysis

  • Integration approaches:

    • Meta-analysis of multiple datasets

    • Cross-validation with different techniques (RNA-seq, qRT-PCR, proteomics)

    • Consideration of post-transcriptional regulation

    • Functional verification through multiple phenotypic assays

  • Case study from literature:
    While specific contradictions for KAT2 are not mentioned in the search results, potassium channel genes often show tissue-specific and stress-specific regulation patterns. For example, different K+ transporters show opposite expression patterns under salt stress (some upregulated, others downregulated), suggesting complementary roles in maintaining ion homeostasis .

What are the most promising approaches for engineering KAT2 to enhance salt tolerance in crops?

Engineering KAT2 channels for enhanced salt tolerance represents a promising avenue for crop improvement. Based on current understanding of potassium channels and salt stress responses, several approaches can be considered:

  • Targeted mutations for altered channel properties:

    • Modification of voltage-sensing domains to alter activation thresholds

    • Engineering selectivity filter residues to enhance K+/Na+ selectivity

    • Alteration of regulatory domains to modify stress-responsive gating

  • Promoter engineering strategies:

    • Use of stress-inducible promoters for conditional expression

    • Tissue-specific promoters targeting expression to salt-sensitive tissues

    • Synthetic promoters with enhanced response elements

  • Protein fusion approaches:

    • Creating chimeric channels with beneficial properties from salt-tolerant species

    • Adding regulatory domains from stress-responsive proteins

    • Engineering salt-sensing domains for direct channel modulation

  • Metabolic engineering considerations:

    • Coordination with other ion transport systems

    • Integration with osmolyte production pathways

    • Energy efficiency of transport processes

  • Validation methods:

    • Electrophysiological characterization of engineered channels

    • Whole-plant phenotyping under varying salt stress conditions

    • Field testing in saline environments (with appropriate regulatory approval)

How can systems biology approaches integrate KAT2 function into broader stress response networks?

Systems biology approaches offer powerful frameworks for understanding KAT2 function within the context of broader stress response networks:

  • Multi-omics integration strategies:

    • Transcriptomics: RNA-seq data on stress-responsive gene networks

    • Proteomics: Identification of KAT2 interactors and post-translational modifications

    • Metabolomics: Analysis of ion content and metabolite changes

    • Phenomics: High-throughput phenotyping of stress responses

  • Mathematical modeling approaches:

    • Dynamic models of ion transport across membranes

    • Ordinary differential equation models of signaling networks

    • Flux balance analysis of ion homeostasis

    • Machine learning for pattern recognition in stress responses

  • Network analysis frameworks:

    • Gene regulatory networks controlling KAT2 expression

    • Protein-protein interaction networks involving KAT2

    • Signaling cascades linking stress perception to channel regulation

    • Integration of transcription factor binding data

  • Visualization and analysis tools:

    • Cytoscape for network visualization

    • R/Bioconductor packages for statistical analysis

    • PathVisio for pathway modeling

    • KEGG and PlantReactome for pathway mapping

The gene network analysis from the search results indicates that transcription factors and translation initiation factors form major gene networks active in the nucleus, cytoplasm, and mitochondria, while membrane and vesicle-bound proteins form a secondary network active in the plasma membrane and vacuoles . Integrating KAT2 into these networks would provide insights into its regulatory context.

What are the implications of KAT2 regulation for broad-spectrum stress tolerance?

Understanding KAT2 regulation has implications beyond salt stress tolerance, potentially contributing to broad-spectrum stress resilience in crops:

  • Cross-talk between stress response pathways:

    • Salt stress and drought stress signaling overlap

    • Potassium homeostasis affects responses to multiple abiotic stresses

    • ROS signaling as a common element in various stress responses

  • Hormonal regulation of KAT2 and stress responses:

    • Abscisic acid (ABA) signaling affects ion channel activity

    • Ethylene response factors (shown to be differentially expressed under salt stress)

    • Jasmonates and salicylic acid in biotic/abiotic stress cross-talk

  • Evolutionary considerations:

    • Conservation of KAT2 function across plant species

    • Adaptation of regulatory mechanisms in stress-tolerant varieties

    • Potential for knowledge transfer between model and crop species

  • Practical applications in breeding programs:

    • Marker-assisted selection for beneficial KAT2 alleles

    • KAT2 expression as a biomarker for stress tolerance

    • Stacking of multiple ion transport traits for robust stress tolerance

The extensive analysis of salt-responsive genes in rice indicates that about 1.36% (578 genes) of the entire transcriptome is involved in major molecular functions such as signal transduction (>150 genes), transcription factor activity (81 genes), and translation factor activity (62 genes) under salt stress . This suggests that KAT2 regulation is part of a complex, interconnected response system that could be leveraged for developing broad-spectrum stress tolerance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.