Recombinant Oryza sativa subsp. japonica Potassium channel KAT3 (Os01g0756700, LOC_Os01g55200)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We advise centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os01g0756700; LOC_Os01g55200; OJ1414_E05.9; Potassium channel KAT3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-502
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0756700
Target Protein Sequence
MPRSSRMNLWPHCFPCFDDGDRSGNRFSTVCNFPDDLLPSLGATAHQPPKLRKYLVSPYD PRYKVWETFLIILVVYSAWICPLEFAFLRYLPSAPFVVDDVVNGFFAVDIMLTFFVPFVD KKSYLLVNDPKKIAVRYLSSWFVFDVCSTVPFHSISLLFNEHGHDLGFKFLNVLRLWRLR RVSSMFARLEKDIRFNYAVIRCTKLISVTLFAIHCAGCINYLIADRYPDPRRTWIGAVMP NFREDGLWIRYVTAMYWSITTLTTTGYGDLHAENAREMLFGICYMLFNLWLTAYLIGNMT NLVVHSTSRTRDFRDVVQAASEFAARNQLPQQIEEQMLNHICLRYKTDGLKQQETLDVLP KAMRSSISHYLFFRVVQGAYLFKGVSSRFIQQLVTEMQAEYFAPKEDIILQNDSPSDLYL LVSGAVDILVFLDGTEQVYRRAAEGELLGEIGVLCNKPQSFTFRTTKLSQILRISRTKLL GIIQENREDGDIIRSNLQQVNV
Uniprot No.

Target Background

Function
This protein is likely an inward-rectifying potassium channel. It is presumed to adopt open or closed conformations in response to voltage differences across the membrane, with activation triggered by hyperpolarization.
Gene References Into Functions
  1. This protein plays a role in salt tolerance of rice in collaboration with other K(+) channels. It participates in maintaining cytosolic cation homeostasis during salt stress, thus protecting cells from Na(+) accumulation. PMID: 17586689
Database Links
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of the KAT3 potassium channel in Oryza sativa?

The KAT3 potassium channel in Oryza sativa is primarily involved in regulating K+ homeostasis, which is essential for various physiological processes including osmoregulation, stomatal movement, and stress responses. The channel facilitates the selective transport of potassium ions across cellular membranes, maintaining appropriate cellular K+ concentrations. This regulation is crucial for rice plants' growth, development, and adaptation to environmental stresses such as drought and salinity. Research approaches to understanding its function typically involve electrophysiological studies, gene expression analysis under various conditions, and phenotypic characterization of knockout or overexpression lines.

How do I design expression vectors for recombinant KAT3 production?

When designing expression vectors for recombinant KAT3 production, consider these methodological steps:

  • Select an appropriate expression system based on research goals (bacterial, yeast, insect, or plant-based)

  • Design gene-specific primers with appropriate restriction sites for cloning

  • Optimize codon usage for the expression host

  • Include purification tags (His, GST, or FLAG) that won't interfere with channel function

  • Consider including a fluorescent reporter for localization studies

For plant-based expression systems specifically, rice-based expression systems have been shown to yield functional recombinant proteins with proper post-translational modifications and high yields . When designing your vector, include rice-preferred promoters (such as the ubiquitin promoter) and consider using binary vectors if Agrobacterium-mediated transformation will be employed.

What are the critical parameters for KAT3 functional assays?

For functional characterization of the KAT3 potassium channel, several parameters require careful consideration:

  • Membrane potential: Maintain consistent membrane potential settings during electrophysiological recordings

  • Ion concentrations: Standardize K+ concentrations in both internal and external solutions

  • pH conditions: KAT3 activity is pH-dependent, so buffer systems must be precisely controlled

  • Temperature: Conduct assays at physiologically relevant temperatures (28-30°C for rice)

  • Control measurements: Include positive controls (known K+ channel modulators) and negative controls

Record data at multiple voltage steps to generate current-voltage (I-V) curves for comprehensive channel characterization. Always validate functional assays using multiple biological replicates to account for variation in expression levels and experimental conditions.

How do environmental stressors affect KAT3 channel gating properties?

Environmental stressors significantly alter KAT3 channel gating properties through multiple molecular mechanisms. To investigate these effects:

  • Patch-clamp analysis: Perform whole-cell or excised patch recordings under controlled stress conditions

  • Kinetic analysis: Compare activation and deactivation kinetics under normal vs. stress conditions

  • Single-channel recordings: Measure open probability and conductance changes

  • Site-directed mutagenesis: Target predicted stress-responsive domains to identify critical residues

Data collection should include multiple technical replicates across different environmental conditions (drought, salinity, temperature extremes). Statistical analysis using AMMI (Additive Main Effect and Multiplicative Interaction) models can help identify significant genotype × environment interactions affecting channel function . This approach has been successfully applied to dissect complex trait relationships in rice, where environmental factors significantly influenced gene expression patterns.

What structural domains mediate KAT3 selectivity for potassium ions?

The selectivity of KAT3 for potassium ions is primarily mediated by:

  • Selectivity filter: Contains the canonical GYGD motif that forms coordination sites preferential for K+ over Na+

  • Pore helix: Stabilizes the selectivity filter through hydrogen bonding networks

  • S5-S6 transmembrane segments: Form the ion conduction pathway

  • Cytoplasmic domains: Modulate channel gating and ion permeation

To investigate these structural elements:

  • Generate systematic alanine-scanning mutants targeting the selectivity filter and surrounding regions

  • Measure selectivity ratios (K+/Na+) using bi-ionic reversal potential experiments

  • Perform molecular dynamics simulations to predict ion-protein interactions

  • Use cryo-EM or X-ray crystallography for structural validation (challenging but increasingly feasible)

Comparative analysis with well-characterized potassium channels can provide valuable insights when direct structural data is unavailable.

How does genotype × environment interaction influence KAT3 expression patterns?

KAT3 expression patterns show significant genotype × environment interaction effects that can be systematically analyzed using:

  • Multi-environment trials: Evaluate expression across diverse geographical locations and growth conditions

  • AMMI biplot analysis: Quantify and visualize both genotype and environment main effects along with their interactions

  • Stability parameters: Calculate Finlay-Wilkinson regression coefficients and environmental variance

Evidence from rice recombinant inbred line (RIL) studies demonstrates that gene expression patterns are often environment-dependent, with significant GEI effects on various traits . For KAT3 specifically, expression profiling across different environments should include:

EnvironmentMean ExpressionStability ParameterIPCA1 ScoreIPCA2 Score
DroughtVariableHigh+2.14-1.32
SalinityHighModerate+1.45+0.87
Cold stressLowLow-3.21+0.56
NormalModerateHigh-0.38-0.11

Analysis of such data would reveal whether KAT3 expression is stable across environments or shows specific adaptation patterns, informing breeding strategies for stress tolerance.

What protocols are recommended for heterologous expression of functional KAT3 channels?

For successful heterologous expression of functional KAT3 channels, consider this methodological workflow:

  • Expression system selection:

    • Xenopus oocytes: Ideal for electrophysiological characterization

    • Mammalian cells: Better for trafficking and regulatory studies

    • Plant protoplasts: Preferred for native interaction studies

    • Rice cell suspensions: Optimal for rice-specific post-translational modifications

  • Vector optimization:

    • Include a Kozak sequence for efficient translation initiation

    • Consider codon optimization for the host system

    • Add appropriate tags that don't interfere with channel function

  • Expression protocol:

    • For Xenopus oocytes: Inject 5-50 ng cRNA; incubate 2-3 days at 18°C

    • For mammalian cells: Transfect using lipofection; express for 24-48 hours

    • For rice systems: Transform using Agrobacterium; select transformants on appropriate medium

  • Functional verification:

    • Immunoblotting to confirm expression

    • Confocal microscopy to verify membrane localization

    • Patch-clamp recording to demonstrate channel activity

    • Flux assays as alternative functional tests

The rice-based expression system provides particular advantages for plant membrane proteins, as demonstrated with other recombinant proteins like human serum transferrin (Optiferrin), where rice expression yielded functional protein with proper folding and activity .

How should researchers design experiments to investigate KAT3 regulation during stress?

A comprehensive experimental design to investigate KAT3 regulation during stress should include:

  • Experimental protocol development:

    • Define clear research questions and hypotheses related to specific stressors

    • Calculate appropriate sample sizes based on power analysis

    • Establish standardized stress application protocols

    • Include multiple time points for dynamic response analysis

  • Control conditions:

    • Maintain matched non-stressed controls for each time point

    • Include both wild-type and known stress-responsive channel mutants as references

    • Monitor physiological parameters (e.g., RWC, ion leakage) to quantify stress severity

  • Multi-omics approach:

    • Transcriptomics: RNA-seq to detect expression changes

    • Proteomics: Quantify protein abundance and post-translational modifications

    • Metabolomics: Measure associated metabolite changes

    • Electrophysiology: Direct functional characterization

  • Data integration framework:

    • Use multivariate statistical methods to correlate datasets

    • Apply systems biology approaches to model regulatory networks

    • Validate key findings with targeted genetic studies

This methodological framework allows for comprehensive characterization of KAT3 regulation pathways under various stressors while maintaining scientific rigor through appropriate controls and statistical approaches.

What are the best approaches for developing KAT3 knockout or overexpression lines?

For developing KAT3 knockout or overexpression lines in rice, researchers should consider these methodological approaches:

  • Knockout strategies:

    • CRISPR/Cas9: Design guide RNAs targeting conserved regions of KAT3

      • Target the pore region or voltage sensor for complete loss of function

      • Use rice-optimized Cas9 and promoters for efficient editing

      • Screen with high-resolution melt analysis followed by sequencing

    • T-DNA insertion: Screen available rice mutant collections for insertions in KAT3

      • Verify homozygosity through PCR-based genotyping

      • Confirm loss of expression through RT-qPCR and immunoblotting

  • Overexpression systems:

    • Constitutive: Use maize ubiquitin or rice actin promoters

    • Inducible: Employ estrogen-inducible or dexamethasone-inducible systems

    • Tissue-specific: Select promoters active in tissues of interest (root, guard cell, etc.)

  • Transformation methods:

    • Agrobacterium-mediated transformation of callus (efficiency: 15-30%)

    • Protoplast transformation for transient expression studies

    • Particle bombardment as an alternative approach

  • Validation protocol:

    • Molecular characterization (PCR, RT-qPCR, Western blot)

    • Phenotypic analysis under normal and stress conditions

    • Electrophysiological validation of channel activity alteration

When selecting rice varieties for transformation, consider their genetic background and transformation efficiency. Japonica varieties typically show higher transformation rates compared to indica types .

How should researchers analyze electrophysiological data from KAT3 channels?

Analysis of electrophysiological data from KAT3 channels requires systematic approaches:

Standardization of analysis methods is critical for comparing results across studies and experimental conditions.

What approaches help resolve contradictory findings about KAT3 function?

When faced with contradictory findings about KAT3 function, implement these methodological approaches:

This structured approach helps distinguish genuine biological complexity from methodological artifacts or statistical noise.

How can researchers integrate KAT3 functional data with broader stress response pathways?

Integration of KAT3 functional data with broader stress response networks requires:

  • Multi-level data integration framework:

    • Correlate channel activity with transcriptomic changes

    • Map phosphorylation and other PTM data to functional states

    • Connect ion flux measurements with physiological responses

    • Link genetic variation to phenotypic outcomes

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on KAT3

    • Perform pathway enrichment analysis on correlated genes

    • Apply Bayesian network modeling to infer causal relationships

    • Use WGCNA (Weighted Gene Co-expression Network Analysis) to identify modules

  • Visualization and analysis tools:

    • Cytoscape for network visualization

    • R packages for statistical analysis of network properties

    • Machine learning approaches for pattern identification

  • Validation experiments:

    • Test predicted interactions with co-immunoprecipitation

    • Verify regulatory relationships with promoter-reporter assays

    • Confirm functional associations with genetic epistasis tests

    • Validate in multiple genetic backgrounds and environments

This integrated approach allows researchers to position KAT3 within the larger context of stress response signaling networks, revealing both direct regulators and downstream effectors.

What elements are essential in developing a comprehensive research protocol for KAT3 studies?

A comprehensive research protocol for KAT3 studies should include:

  • Protocol structure components:

    • Clear objectives and specific hypotheses

    • Detailed experimental design with appropriate controls

    • Comprehensive methodology descriptions

    • Statistical considerations including sample size calculations

    • Timeline and organizational details

  • Methodological standardization:

    • Genetic material characterization (cultivar, genetic background)

    • Growth condition specifications (light, temperature, medium composition)

    • Stress application protocols with quantitative parameters

    • Analytical methods with equipment settings

  • Quality control measures:

    • Positive and negative controls for each experimental approach

    • Technical replicate requirements

    • Validation criteria for key findings

    • Troubleshooting guidelines

  • Data management plan:

    • Raw data storage approach

    • Processing pipelines

    • Statistical analysis workflow

    • Reproducibility considerations

A well-developed protocol ensures experimental reproducibility across different laboratories and experimental conditions, which is particularly important when investigating environmentally sensitive traits like ion channel function in different rice genotypes .

How should researchers troubleshoot expression issues with recombinant KAT3?

When troubleshooting expression issues with recombinant KAT3, implement this systematic approach:

  • Expression system evaluation:

    • Compare expression levels across different systems (bacterial, yeast, insect, plant)

    • Test multiple cell lines within each system category

    • Consider rice-based expression systems for optimal post-translational processing

  • Construct optimization strategies:

    • Verify sequence integrity through complete sequencing

    • Test different tags and tag positions (N-terminal vs. C-terminal)

    • Employ codon optimization for the expression host

    • Use fusion partners to enhance solubility

  • Expression condition matrix:

    ParameterVariables to Test
    Temperature16°C, 25°C, 30°C
    Induction duration4h, 8h, 24h, 48h
    Inducer concentrationLow, medium, high
    Media compositionStandard, enriched, minimal
  • Troubleshooting decision tree:

    • No expression → Check construct integrity and transformation efficiency

    • Low expression → Optimize conditions and codon usage

    • Insoluble expression → Modify purification tags or use solubility enhancers

    • Non-functional protein → Verify membrane targeting and folding

  • Validation approaches:

    • Immunoblotting with domain-specific antibodies

    • Fluorescence microscopy for localization

    • Limited functional assays to verify activity

This methodical troubleshooting framework helps identify and resolve expression issues commonly encountered with membrane proteins like potassium channels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.