Recombinant Oryza sativa subsp. japonica Potassium channel KAT4 (Os06g0254200, LOC_Os06g14310)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Os06g0254200; LOC_Os06g14310; P0046H10.36; P0592E11.6; Potassium channel KAT4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os06g0254200
Target Protein Sequence
MAARSELLRPAFGEASPSLGRFVINPHSCSYRWWHMFLIMLVLYSAWASPFELSMEKAAS IALVVTDLVVDVFFAIDIALSFFVAYRDTSTGLLITDRRKITMRYLKRPCFALDVASTIP LQIIYQLVTGKRQGLWGLLNLLRLWRLRRVSKLFARVEKDIRFNYLWTRLIKLLCVTLFA LHFAACIYLWMAFNYKIKELTWIGSQIHSFEDRSVWFCYTCAVYWSITTLATVGYGDLHA TNIGEMLFSIAFMLFNMGLTSYIIGNITNLVVRETSNTFKMRDMVQRVSEFGRMNRLPEA MREQMLASVQLRFRTDEQLQQEMLSELPKAVRSGVMKHMFKSAIESCYLFQGVSDSLIVQ LVAEMKAEFFPPKANVILENETSTDCYIIISGEVEALTTLADGTEKHVKRIGPRGMAGEI GVMFSIPQPFTIRSRRLTQVVRISHIHLLQAVRPNTADGYIVFSNFIQYLESLKVQTKDV AFVSDHLWNGNSMVLRRATEVAVDESKEAAHKMLPCKEPKRVVIHEQLPNATSTALHPSP GKLVLLPDSMQELMKLSEKKFGKAVRGILTVEGAEVEDIEVIRDGDHLLFS
Uniprot No.

Target Background

Function
This protein is likely an inward-rectifying potassium channel. It is expected to transition between open and closed conformations in response to voltage differences across the membrane, and it is activated by hyperpolarization.
Database Links
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the functional roles of potassium channels like KAT4 in rice physiology?

Potassium channels, including KAT4, perform several critical functions in rice physiology:

  • Membrane potential regulation: They conduct potassium ions down their electrochemical gradient to set or reset the resting potential in many cells .

  • Action potential modulation: In excitable cells, the delayed counterflow of potassium ions through these channels helps shape action potentials .

  • Stress response mediation: Potassium channels play significant roles in abiotic stress responses, which constituted approximately 15% of all CRISPR-based rice studies according to recent analyses .

  • Developmental regulation: Potassium homeostasis affects multiple developmental processes in rice, contributing to chlorophyll synthesis and leaf morphology, as evidenced by targeted genome editing studies .

Understanding these functions has important implications for rice breeding programs aimed at stress tolerance and yield improvement.

What are the recommended protocols for handling and storing recombinant KAT4 protein?

For optimal results when working with recombinant KAT4 protein, follow these methodological guidelines:

Storage conditions:

  • Store the lyophilized powder at -20°C/-80°C upon receipt .

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles .

  • Working aliquots can be stored at 4°C for up to one week .

Reconstitution procedure:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom .

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% and aliquot for long-term storage at -20°C/-80°C .

Quality control checkpoints:

  • Verify protein purity (>90%) via SDS-PAGE before experimental use .

  • The reconstituted protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for optimal stability .

How can researchers effectively express and purify recombinant KAT4 protein for functional studies?

Effective expression and purification of KAT4 involves several critical steps:

  • Expression system selection: E. coli has been successfully used for KAT4 expression, as evidenced by commercially available recombinant forms .

  • Construct design considerations:

    • The full-length construct (amino acids 1-591) with an N-terminal His-tag facilitates both expression and purification .

    • Codon optimization for E. coli may improve expression yields, though this should be empirically tested.

  • Purification strategy:

    • Implement immobilized metal affinity chromatography (IMAC) using the His-tag.

    • Consider adding a second purification step (e.g., ion exchange or size exclusion chromatography) to achieve higher purity for functional studies.

    • Monitor purity levels using SDS-PAGE, aiming for >90% purity .

  • Activity verification:

    • Functional verification through electrophysiological assays is recommended, as structural integrity does not guarantee channel functionality.

How can CRISPR-Cas9 genome editing be applied to study KAT4 function in rice?

CRISPR-Cas9 offers powerful approaches for investigating KAT4 function through precise genetic modifications:

Methodological approach:

  • Target site selection: Design sgRNAs targeting conserved domains of the KAT4 gene (Os06G0254200) using established rice CRISPR protocols.

  • Vector construction: Construct CRISPR vectors following established rice genome editing workflows, which have been successfully applied to over 129 rice genes across two developmental phases (2013-2020) .

  • Rice transformation: Transform appropriate rice cultivars, with Japonica varieties like Nipponbare showing higher transformation efficiency than Indica varieties .

  • Mutation verification: Confirm edits using sequencing and assess protein expression changes.

  • Phenotypic characterization: Analyze resulting phenotypes under various conditions, particularly focusing on potassium homeostasis and stress responses.

Strategic considerations:

  • Multiple studies have demonstrated successful CRISPR-Cas editing in rice, with ~24.75 genes edited per year during the second phase (2017-2020) of rice CRISPR development .

  • For KAT4 specifically, both knock-out and precise editing approaches can be employed, depending on the research question.

  • Consider potential off-target effects by utilizing the latest CRISPR design tools.

What electrophysiological techniques are most suitable for characterizing KAT4 channel activity?

Characterizing KAT4 channel activity requires specialized electrophysiological techniques:

Patch clamp methodology:

  • Heterologous expression systems: Express KAT4 in systems like Xenopus oocytes, HEK293 cells, or plant protoplasts.

  • Whole-cell recordings: Measure whole-cell currents to characterize basic channel properties including:

    • Reversal potential

    • Conductance

    • Activation/inactivation kinetics

    • Voltage dependence

  • Single-channel recordings: Capture single-channel events to determine:

    • Unitary conductance

    • Open probability

    • Mean open/closed times

Two-electrode voltage clamp (TEVC) in Xenopus oocytes offers a robust system for initial characterization, while automated patch clamp systems can enable higher-throughput screening of channel modulators or mutations.

How does KAT4 compare structurally and functionally to other potassium channels in rice?

KAT4 belongs to a diverse family of potassium channels in rice, with distinct structural and functional properties:

Comparative structural features:

FeatureKAT4Inward-rectifier K+ channelsVoltage-gated K+ channelsCalcium-activated K+ channels
Transmembrane domainsMultiple2 transmembrane segments6 transmembrane segments6-7 transmembrane segments
Pore structureK+-selectiveK+-selectiveK+-selectiveK+-selective
Regulatory domainsN-terminalIntracellular vestibuleVoltage-sensing S4 domainCa2+-binding domain
Primary activationUnknownMembrane hyperpolarizationMembrane depolarizationIncreased cytosolic Ca2+

Functional distinctions:

  • Potassium channels in rice can be categorized into four major classes based on their activation mechanisms and structural properties :

    • Calcium-activated potassium channels

    • Inwardly rectifying potassium channels

    • Tandem pore domain potassium channels

    • Voltage-gated potassium channels

  • These channels contribute to various physiological processes including action potential regulation, hormone secretion, and vascular tone maintenance .

How might alterations in KAT4 function contribute to rice stress tolerance?

Potassium channels play critical roles in stress adaptation mechanisms in plants. Approaches to investigate KAT4's contribution include:

  • Drought stress response: Analyze KAT4 expression patterns under water deficit conditions, as potassium channels regulate stomatal function which directly impacts water use efficiency.

  • Salt stress tolerance: Examine how KAT4 modulation affects Na+/K+ homeostasis, a critical aspect of salinity tolerance in rice.

  • Temperature stress adaptation: Investigate KAT4's role in membrane integrity maintenance under temperature extremes, as potassium flux contributes to thermotolerance mechanisms.

  • Integrated approaches: As demonstrated in recent rice research, approximately 15% of CRISPR-based studies address abiotic stress response genes, highlighting the importance of ion transporters in environmental adaptation .

What bioinformatic approaches can help predict KAT4 interaction networks in rice?

Advanced bioinformatic methodologies to investigate KAT4 interaction networks include:

  • Protein-protein interaction prediction:

    • Use tools like STRING, IntAct, or rice-specific databases to identify potential interacting partners.

    • Apply co-expression analysis using rice transcriptome datasets to identify genes with expression patterns similar to KAT4.

  • Structural modeling and docking:

    • Generate structural models of KAT4 using the full amino acid sequence and homology modeling based on crystallized potassium channels.

    • Perform in silico docking studies to predict interactions with regulatory proteins or inhibitors.

  • Phylogenetic analysis:

    • Compare KAT4 (Os06G0254200) with other potassium channels across plant species.

    • Analyze the conservation patterns across different rice varieties (Japonica vs. Indica).

  • Integration with functional genomics data:

    • Leverage the extensive rice genome editing resources developed in recent years, with over 129 rice genes studied using CRISPR systems .

How might advanced genome editing techniques extend our understanding of KAT4 beyond conventional CRISPR knockouts?

Future research on KAT4 can leverage evolved genome editing technologies:

  • Base editing approaches:

    • Apply cytosine or adenine base editors to introduce specific amino acid substitutions without double-strand breaks.

    • Target conserved residues in the pore region or voltage-sensing domains to alter channel properties rather than eliminate function.

  • Prime editing strategies:

    • Implement precise edits to introduce specific mutations or small insertions/deletions.

    • Engineer specific regulatory elements in the KAT4 promoter region to alter expression patterns.

  • Multiplexed editing:

    • Target KAT4 alongside other potassium channels to address functional redundancy.

    • Create combinatorial mutations based on the insights from rice CRISPR research, which has successfully targeted multiple genes simultaneously .

  • Knock-in approaches:

    • Introduce reporter tags for live imaging of KAT4 localization and trafficking.

    • Create epitope-tagged versions for interaction studies.

Recent advances in rice genome editing show these techniques are increasingly feasible, with the field evolving rapidly from the first (2013-2016) to second phase (2017-2020) of rice CRISPR development .

What are the challenges and solutions for expressing functional plant membrane proteins like KAT4 in heterologous systems?

Expressing functional plant membrane proteins presents several challenges that require specialized approaches:

Key challenges:

  • Protein misfolding and aggregation:

    • Issue: Complex membrane proteins often misfold in heterologous systems.

    • Solution: Optimize expression conditions (temperature, induction time) or use specialized E. coli strains designed for membrane protein expression.

  • Post-translational modifications:

    • Issue: Plant-specific modifications may be absent in bacterial systems.

    • Solution: Consider eukaryotic expression systems (yeast, insect cells) for more complex modifications.

  • Functional reconstitution:

    • Issue: Achieving proper membrane insertion and functional conformation.

    • Solution: Develop proteoliposome reconstitution protocols or nanodiscs for functional studies.

Methodological strategies:

ChallengeTraditional ApproachAdvanced Solution
Low expression yieldsCold induction (16°C)Designer E. coli strains (C41/C43)
Protein solubilityDetergent screeningNovel solubilization agents (SMALPs, amphipols)
Functional verificationRadioactive flux assaysFluorescence-based assays or electrophysiology
Structural studies2D crystallizationCryo-EM or X-ray crystallography with fusion partners

Current recombinant production systems have successfully expressed KAT4 in E. coli with high purity (>95%) , but functional characterization may require more sophisticated approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.