Recombinant Oryza sativa subsp. japonica Potassium channel KAT6 (Os01g0718700, LOC_Os01g52070)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os01g0718700; LOC_Os01g52070; OsJ_03266; Potassium channel KAT6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0718700
Target Protein Sequence
MAASRSELLRPAFGEPSPSLGPFVVNPHTCSYRWWQKFLIVLVLYTAWASPFELAMEKSA SAALAVTELVVDAFFAVDIAVSFFVAYRDASTGLLVTDRKKIATRHLARPCLALDVASTI PLQMIYRIVSGKRQALYGLLNLLRLWRLRRVSKLFARLEKDIRFSYLWTRLIKLLYVTLF AVHFASCIYLWMAFHHKAKELTWIGSQFHGFEDRSVWFCYTCAVYWSITTLATVGYGDLH AANTGEMLFSIAFMLFNMGLTSYIIGNITNLVVHETTNTFKMRDMVQRTSVFGRTNRLPV AMREQMMESLQLRFRAEEQLQQEMLSELPKAVRSGIAQHMFRGAVQSCYLFQGVSDKLVL PLVAEMKAESFPPKADIILENEASTDCYIIVSGEVEVLTTLEDGTEKQVMRIGPRGMAGE IGVMFNIPQPFTIRSRKLTQLVRISHSHMVSTIRPNTADGVVVFSNFVLYLESLKVKAKE TAFVRDHLRNGYSTVLGSATMFDVDESKESAHKMLPCKEPKRVSIHEHLLNGTGTALNGS SGKLVILPDSMQDLMKLSEKKFGKAARGILTVGGAEVEDIEVIRDGDHLFFSW
Uniprot No.

Target Background

Function
This protein is likely an inward-rectifying potassium channel. The channel is activated by hyperpolarization, transitioning between open and closed conformations in response to changes in membrane voltage.
Database Links
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the potassium channel KAT6 in rice and what is its function?

Potassium channel KAT6 (Os01g0718700) in Oryza sativa subsp. japonica is a membrane protein involved in potassium ion transport across cell membranes. It belongs to the potassium channel family, which plays critical roles in various cellular processes including enzyme activation, cell turgor regulation, and nutrient movement within plant cells .

This channel is classified in the broader context of rice potassium channels, which can function in either inward or outward transport of potassium ions. While the search results don't specifically detail KAT6's directional transport preference, its classification suggests it may serve as a voltage-gated potassium channel based on structural similarities to other characterized channels in rice .

The methodological approach to studying KAT6 function typically involves electrophysiological measurements in heterologous expression systems (such as Xenopus oocytes or yeast cells), where channel activity can be monitored through patch-clamp techniques. Additionally, knockout or knockdown studies in rice plants can help elucidate the physiological consequences of KAT6 dysfunction in planta.

What is the molecular structure and organization of the KAT6 gene in rice?

The KAT6 gene in Oryza sativa japonica (Os01g0718700) encodes a protein with a predicted length of 593 amino acids . Based on the available sequence data, the gene has been characterized through computational analysis methods and has corresponding sequence entries in databases with accession numbers XM_015783631.1 and XM_026024361.1 .

The protein encoded by this gene has been identified as "potassium channel KAT6-like" in both database entries . The reference sequence was derived from genomic sequence NW_015379174.1 using the Gnomon gene prediction method .

For researchers seeking to study KAT6 gene structure, methodological approaches would include:

  • PCR amplification of genomic DNA and cDNA to analyze intron-exon boundaries

  • 5' and 3' RACE (Rapid Amplification of cDNA Ends) to confirm transcription start and termination sites

  • Promoter analysis using reporter gene constructs to identify regulatory elements

  • Comparison with other potassium channel genes in rice to identify conserved structural features

The structure of potassium channel genes in rice generally varies in exon number from as few as one (as seen in NKT5) to as many as 11 (seen in several other K+ channel genes) , though the specific exon count for KAT6 is not explicitly stated in the search results.

What are the physicochemical properties of the KAT6 protein?

While specific physicochemical properties for KAT6 are not detailed in the search results, we can infer some information from related potassium channels in rice. Potassium channel proteins in rice have been characterized with molecular weights ranging from 33.54 kDa to 104.46 kDa and isoelectric points (pI) ranging from 5.78 to 10.39 .

For researchers studying KAT6's physicochemical properties, recommended methodological approaches include:

  • Protein expression and purification: The recombinant full-length protein is available commercially with a His-tag for purification purposes . For researchers synthesizing it in-house, bacterial expression systems (particularly E. coli) have been used successfully for rice potassium channels .

  • Analytical techniques:

    • Size exclusion chromatography to determine oligomeric state

    • Circular dichroism spectroscopy to assess secondary structure content

    • Thermal shift assays to evaluate stability under different conditions

    • Mass spectrometry for accurate molecular weight determination and post-translational modification analysis

  • Membrane insertion analysis: As a transmembrane protein, KAT6 requires special consideration for its hydrophobic domains. Techniques such as tryptophan fluorescence spectroscopy and oriented circular dichroism can help determine membrane insertion properties.

  • Electrophysiological characterization: Patch-clamp recording remains the gold standard for functional characterization, providing information about conductance, gating kinetics, and ion selectivity.

How does KAT6 compare to other potassium channels in the rice genome?

The rice genome contains multiple potassium channel genes with diverse properties and functions. While the search results don't provide a direct comparison of KAT6 to other channels, we can contextualize it within the broader potassium channel family in rice.

Rice potassium channels can be classified based on their transport direction (inward or outward rectifying) and structural features. For example, OsAKT1 (Os01g0648000) is an inward-rectifying potassium channel with 935 amino acid residues and a molecular weight of 104.46 kDa . Other characterized channels include outward potassium channels like Os01g0696100 (33.54 kDa) and Os06g0250600 (described as an outward shaker K+ channel) .

For researchers conducting comparative studies, recommended methodological approaches include:

  • Phylogenetic analysis: Construct phylogenetic trees using multiple sequence alignment tools (MUSCLE, ClustalW) followed by tree-building algorithms (Maximum Likelihood, Neighbor-Joining) to determine evolutionary relationships.

  • Domain structure comparison: Use tools like SMART, Pfam, and InterPro to annotate functional domains and compare domain architecture across different potassium channels.

  • Expression pattern analysis: RNA-seq data mining or qRT-PCR experiments can reveal tissue-specific or condition-dependent expression patterns that distinguish KAT6 from other potassium channels.

  • Functional complementation: Express different potassium channels in yeast mutants lacking endogenous potassium transporters to compare their functional capabilities under controlled conditions.

  • Electrophysiological comparison: Standardized electrophysiology protocols using the same expression system can provide direct functional comparisons of channel properties.

What experimental approaches can resolve contradictory data about KAT6 channel kinetics?

When facing contradictory findings about KAT6 channel kinetics, researchers should implement a systematic troubleshooting approach:

How does the KAT6 channel interact with other proteins in rice cellular signaling networks?

Understanding KAT6's protein interaction network is crucial for elucidating its role in rice physiology. While specific KAT6 interaction partners are not detailed in the search results, methodological approaches to identify and characterize these interactions include:

  • Yeast two-hybrid (Y2H) screening:

    • Use different KAT6 domains as baits (N-terminus, transmembrane domains, C-terminus)

    • Screen against rice cDNA libraries from relevant tissues

    • Validate positive interactions through co-immunoprecipitation or bimolecular fluorescence complementation

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged KAT6 in rice cells or heterologous systems

    • Purify KAT6 under conditions that maintain protein-protein interactions

    • Identify co-purifying proteins by mass spectrometry

    • Distinguish true interactors from contaminants using statistical approaches and controls

  • Protein microarrays:

    • Screen purified KAT6 against arrays containing rice proteins

    • Validate hits using orthogonal methods

    • Characterize the binding domains involved in positive interactions

  • Proximity labeling approaches:

    • Fuse KAT6 to enzymes like BioID or APEX2

    • Express in rice cells to label proximal proteins

    • Identify labeled proteins by streptavidin pulldown and mass spectrometry

The search results indicate that techniques such as yeast two-hybrid, co-IP, and pull-down are commonly used to detect protein interactions , though specific KAT6 interactors are not listed.

What role does the KAT6 channel play in rice adaptation to varying potassium availability?

Potassium channels are crucial for plant adaptation to varying potassium availability in the environment. While the search results don't specifically discuss KAT6's role in this process, we can outline methodological approaches to investigate this question:

  • Gene expression analysis under K+ starvation:

    • Expose rice plants to low K+ conditions for various durations

    • Analyze KAT6 expression changes using qRT-PCR or RNA-seq

    • Compare with other potassium channels and transporters to identify coordinated responses

  • Genetic approaches:

    • Generate KAT6 knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Evaluate phenotypes under normal versus low K+ conditions

    • Analyze root architecture changes, K+ content in tissues, and physiological parameters

  • Electrophysiological characterization:

    • Isolate protoplasts from plants grown under different K+ regimes

    • Perform patch-clamp analysis to determine changes in KAT6 activity

    • Correlate channel activity with K+ availability

  • Systems biology approach:

    • Perform genome-wide association studies (GWAS) to identify natural variation in KAT6 associated with K+ efficiency

    • The 1D/2D GWAS approach used for studying rice-Xanthomonas interactions could be adapted to study K+ adaptation

    • This would allow identification of KAT6 variants associated with improved performance under K+ limitation

As demonstrated in the rice-Xanthomonas adaptation study, GWAS methodology can be powerful for understanding genetic systems underlying plant adaptation to environmental challenges . Similar approaches could reveal how KAT6 contributes to potassium homeostasis under varying conditions.

What are the current approaches to engineering KAT6 for improved crop performance?

Engineering potassium channels like KAT6 represents a promising approach for improving crop performance, particularly regarding nutrient use efficiency and stress tolerance. Methodological approaches for KAT6 engineering include:

  • Structure-guided mutagenesis:

    • Target residues involved in gating, ion selectivity, or regulation

    • Generate variants with altered properties (e.g., increased conductance, modified voltage sensitivity)

    • Evaluate effects in heterologous systems before introducing into plants

  • Promoter engineering:

    • Modify KAT6 expression patterns using tissue-specific or stress-inducible promoters

    • Fine-tune expression levels to optimize K+ uptake without disrupting homeostasis

    • Use synthetic promoters with designed cis-regulatory elements for precise control

  • Protein fusion strategies:

    • Create chimeric channels combining functional domains from different K+ channels

    • Add regulatory domains that respond to specific signals (e.g., phosphorylation sites)

    • Develop split-channel approaches for controlled assembly and function

  • Testing engineered variants in planta:

    • Transform rice with engineered KAT6 variants

    • Evaluate phenotypes under controlled conditions and field trials

    • Measure parameters including growth, yield, K+ content, and stress tolerance

  • Genome editing approaches:

    • Use CRISPR-Cas9 to modify endogenous KAT6 precisely

    • Target promoter regions to alter expression patterns

    • Introduce specific amino acid changes to enhance function

The methodological principles used in studying rice-pathogen interactions provide a model for evaluating how engineered KAT6 variants might affect whole-plant physiology and stress responses. The complex genetic interaction systems observed in rice-Xoo interactions suggest that engineered changes should be evaluated in diverse genetic backgrounds to understand their effects across different rice varieties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.