Recombinant Oryza sativa subsp. japonica Probable aquaporin PIP2-3 (PIP2-3)

Shipped with Ice Packs
In Stock

Description

Overview of PIP2-3

PIP2-3 belongs to the plasma membrane intrinsic protein (PIP) family of aquaporins, which regulate water transport across cell membranes in plants . The recombinant form is produced in E. coli with an N-terminal His tag for purification and detection purposes . Its UniProt ID is Q7XUA6, and it is encoded by the PIP2-3 gene (synonyms: Os04g0521100, LOC_Os04g44060) .

Functional Insights

While functional studies on PIP2-3 are less documented than its homologs (e.g., PIP2;2 ), its structural similarity to other PIPs suggests roles in:

  • Water Transport: Facilitating osmotic water permeability across membranes .

  • Stress Response: Potential involvement in drought tolerance by maintaining membrane integrity .

  • Electrolyte Regulation: Mitigating leakage under physiological drought stress .

Key Uses

  • Biophysical Studies: Structural analysis of aquaporin channels .

  • Antibody Production: Polyclonal antibodies against PIP2-3 are available for ELISA and Western blot .

  • Drought Tolerance Mechanisms: Comparative studies with PIP2;2, which enhances H₂O transport and drought resilience .

Comparative Analysis of Rice PIP2 Proteins

FeaturePIP2-3 (This Protein)PIP2;2 (Homolog)
Water Transport EfficiencyPresumed moderateHighest among OsPIPs
Drought ResponseTheoretical roleConfirmed cell protection
Expression SystemE. coliE. coli/plant protoplasts

Challenges and Future Directions

  • Functional Validation: PIP2-3’s substrate selectivity and physiological roles remain understudied compared to PIP2;2 .

  • Structural Studies: High-resolution crystallography could clarify its pore architecture and regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
PIP2-3; Os04g0521100; LOC_Os04g44060; OSJNBa0019D11.16; Probable aquaporin PIP2-3; OsPIP2;3; Plasma membrane intrinsic protein 2-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PIP2-3
Target Protein Sequence
MAKDIEAAAAAEGGEYMAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQSDPGANAADAACSGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIVAQSLGAICGVGLVKGFQSAFYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQHKAWHDHWIFWVGPLIGAAIAAAYHQYVLRASAAKLGSSSSFRG
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Database Links

KEGG: osa:4336424

STRING: 39947.LOC_Os04g44060.1

UniGene: Os.5916

Protein Families
MIP/aquaporin (TC 1.A.8) family, PIP (TC 1.A.8.11) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots.

Q&A

What is aquaporin PIP2-3 in rice and what is its significance?

Aquaporin PIP2-3 (also known as OsPIP2;3) is a member of the plasma membrane intrinsic protein (PIP) family in rice. It belongs to the PIP2 subfamily and functions primarily as a membrane channel protein that facilitates the transport of water and potentially other small molecules across cellular membranes. The PIP family in rice comprises 11 members (OsPIP1;1 to OsPIP1;3 and OsPIP2;1 to OsPIP2;8), which are hypothesized to facilitate the transport of H₂O and other compounds across cell membranes .

PIP2-3 is encoded by the gene Os04g0521100 (LOC_Os04g44060) and is also referred to as OsPIP2;3 or plasma membrane intrinsic protein 2-3 in scientific literature . Its significance lies in its potential role in water transport efficiency, which is crucial for plant water relations, especially under various environmental stress conditions such as drought and salinity. Understanding PIP2-3 function contributes to our knowledge of how rice plants regulate water homeostasis at the cellular level.

How does PIP2-3 compare to other aquaporins in the rice PIP family?

While the provided search results don't offer a direct comparison of all rice PIP family members, we can infer some relationships from the available data:

AquaporinWater Transport EfficiencyKnown FunctionsResponse to Stress
OsPIP1;2Demonstrated substrate selectivityWater transportNot specified in search results
OsPIP2;1Demonstrated substrate selectivityWater transportMay show differential expression under stress
OsPIP2;2Most efficient facilitator of H₂O transport among OsPIPsWater transportNot specified in search results
OsPIP2;3 (PIP2-3)Not directly compared in search resultsProbable water transportNot specified in search results
OsPIP2;4Demonstrated substrate selectivityWater transportNot specified in search results

OsPIP2;2 has been characterized as "the most efficient facilitator of H₂O transport across cell membranes in comparison with the other 10 OsPIPs" . This suggests that different PIP family members may have varying efficiencies in water transport, and PIP2-3 would have its specific transport characteristics that distinguish it from other family members, though direct comparative data is not provided in the search results.

What are the optimal methods for recombinant expression of PIP2-3?

Based on the search results, the following approach has been used successfully for recombinant PIP2-3 expression:

  • Expression System: E. coli is commonly used for recombinant expression of PIP2-3 . This bacterial system allows for relatively high protein yields and simplified purification processes.

  • Construct Design: The full-length protein (1-290 amino acids) is fused to an N-terminal His-tag to facilitate purification and detection . When designing expression constructs for aquaporins:

    • Polyhistidine tags typically vary between six and ten residues

    • For eukaryotic targets like PIP2-3, the tag can be placed at either the N- or C-terminus

    • A protease cleavage site is usually introduced after the N-terminal polyhistidine tag

  • Genetic Considerations: Although not specifically mentioned for PIP2-3, codon optimization has been applied for other eukaryotic aquaporins produced in heterologous hosts, which could improve expression levels .

What are the critical steps in purification of recombinant PIP2-3?

The purification of recombinant PIP2-3 typically involves:

  • Initial Preparation: After expression, cells are harvested and lysed to release the recombinant protein.

  • Affinity Chromatography: The His-tagged PIP2-3 can be purified using metal affinity chromatography (commonly Ni-NTA). The polyhistidine tag allows for specific binding to the resin while contaminants are washed away.

  • Quality Control: Purity assessment is typically performed using SDS-PAGE, with recombinant PIP2-3 showing greater than 90% purity after appropriate purification steps .

  • Final Product Form: The purified protein is supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What are the optimal storage conditions for recombinant PIP2-3?

For optimal stability and activity retention, recombinant PIP2-3 should be stored according to these guidelines:

  • Long-term Storage: Store at -20°C/-80°C upon receipt .

  • Working Aliquots: Store at 4°C for up to one week. Repeated freezing and thawing is not recommended .

  • Aliquoting: Division into multiple small aliquots is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

    • Aliquot for long-term storage at -20°C/-80°C

How can researchers validate the functionality of recombinant PIP2-3 after purification?

Although specific validation methods for PIP2-3 are not detailed in the search results, typical approaches for validating aquaporin functionality include:

  • Water Permeability Assays: Using proteoliposomes or cell-based systems to measure the rate of water transport across membranes containing the recombinant protein.

  • Substrate Specificity Testing: Examining the transport of water versus other potential substrates to confirm the functional characteristics of the protein.

  • Structural Integrity Assessment: Using circular dichroism spectroscopy to confirm proper protein folding.

  • Comparative Analysis: Comparing water transport activity with other well-characterized aquaporins (such as OsPIP2;2, which has been characterized as an efficient water transport facilitator ).

What experimental approaches are recommended for studying PIP2-3 water transport activity?

Based on general aquaporin research methodologies, the following approaches would be suitable for studying PIP2-3 water transport:

  • Xenopus Oocyte Expression System: This is a classical system for functional characterization of aquaporins where water permeability is measured by monitoring the rate of oocyte swelling in hypotonic medium.

  • Proteoliposome-Based Assays: Reconstituting purified PIP2-3 into liposomes and measuring water transport using stopped-flow spectroscopy to monitor vesicle volume changes.

  • Yeast Functional Complementation: Using yeast strains deficient in endogenous aquaporins to test the functionality of heterologously expressed PIP2-3.

  • Cell-Based Assays: Expressing PIP2-3 in mammalian cell lines and measuring cell volume changes in response to osmotic challenges.

How might PIP2-3 respond to abiotic stresses based on studies of similar rice aquaporins?

Although the search results don't provide specific information about PIP2-3's response to abiotic stresses, insights can be gained from studies on rice proteome responses to stress conditions:

  • Drought Stress Response: Rice plants show differential protein expression patterns under various levels of drought stress (mild, moderate, and severe). Key proteins involved in photosynthesis, transport, and translation are affected under drought conditions .

  • Salt Stress Considerations: Proteins respond differently to salt stress compared to drought stress. For example, certain chloroplastic proteins like Glutamate-1-semialdehyde 2,1-aminomutase and Uroporphyrinogen decarboxylase 2 increased in abundance under salt stress but decreased under water deficiency .

  • Temperature Stress Effects: Extreme temperatures elicit unique proteome responses that only partially overlap with other stress responses .

Given that aquaporins play crucial roles in plant water relations, it's reasonable to hypothesize that PIP2-3 might show altered expression or activity under these stress conditions, possibly contributing to the plant's adaptive responses.

What mutagenesis approaches would be most informative for studying PIP2-3 structure-function relationships?

For investigating structure-function relationships in PIP2-3, the following mutagenesis approaches would be informative:

  • NPA Motif Mutations: Modifying the conserved NPA motifs that form the water-selective pore to understand their role in substrate selectivity.

  • Phosphorylation Site Mutations: Identifying and mutating potential phosphorylation sites to understand regulation of PIP2-3 activity, as phosphorylation often regulates aquaporin gating.

  • Ar/R Selectivity Filter Mutations: Modifying amino acids in the aromatic/arginine selectivity filter to examine their role in determining substrate specificity.

  • Loop Modifications: Altering extracellular or cytoplasmic loops to understand their roles in protein trafficking, regulation, and interaction with other cellular components.

  • Transmembrane Domain Mutations: Systematic mutations in transmembrane regions to identify residues critical for channel function, stability, or oligomerization.

How can researchers investigate PIP2-3 interactions with other proteins in rice stress response mechanisms?

To investigate PIP2-3 interactions in stress response contexts, researchers could employ:

  • Co-Immunoprecipitation (Co-IP): Using antibodies against PIP2-3 to pull down interaction partners from rice tissue extracts under various stress conditions.

  • Yeast Two-Hybrid Screening: Identifying potential interacting proteins through library screening approaches.

  • Bimolecular Fluorescence Complementation (BiFC): Visualizing protein-protein interactions in planta by fusing potential interacting partners with complementary fragments of fluorescent proteins.

  • Proteomics Analysis: Comparing protein abundance and modification patterns between wild-type and PIP2-3 knockout/overexpression lines under stress conditions to identify pathways affected by PIP2-3.

Research on rice proteome responses to abiotic stress has identified proteins like Epimerase domain-containing protein (Q2QSR7) and L-ascorbate peroxidase 8 (Q69SV0) that show unique abundance patterns under varying drought stress levels . These proteins might serve as candidates for investigating potential functional relationships with aquaporins like PIP2-3.

How does PIP2-3 compare functionally with aquaporins from other plant species?

While direct comparative data for PIP2-3 is not provided in the search results, a comprehensive analysis would consider:

  • Sequence Conservation: Comparing sequence homology with well-characterized aquaporins from other species to predict functional similarities.

  • Substrate Selectivity: Examining whether PIP2-3 is strictly a water channel or can transport other substrates like some aquaporins that facilitate the movement of glycerol, CO₂, or hydrogen peroxide.

  • Expression Patterns: Comparing tissue-specific expression patterns with homologous aquaporins from other species to identify conserved regulatory mechanisms.

  • Stress Responses: Analyzing whether PIP2-3's response to abiotic stresses resembles that of homologous aquaporins in other species, particularly drought-tolerant plants.

What can we learn from comparing recombinant versus native PIP2-3?

Comparing recombinant and native PIP2-3 can provide valuable insights:

  • Post-translational Modifications: Native PIP2-3 may harbor post-translational modifications (phosphorylation, glycosylation) that affect function and are absent in recombinant versions.

  • Protein-Protein Interactions: Native PIP2-3 exists in a complex cellular environment where interactions with other proteins may affect its localization, stability, or function.

  • Membrane Environment Effects: The lipid composition of native membranes versus artificial systems used for recombinant protein may affect protein conformation and activity.

  • Regulatory Mechanisms: Studying how recombinant PIP2-3 activity differs from native protein can reveal intrinsic regulatory mechanisms that depend on cellular context.

What are common challenges in working with recombinant PIP2-3 and how can they be addressed?

Common challenges with membrane proteins like PIP2-3 include:

  • Low Expression Yields:

    • Solution: Optimize codon usage for the expression host

    • Consider using stronger promoters or specialized expression strains

    • Explore different fusion partners to enhance solubility

  • Protein Misfolding:

    • Solution: Express at lower temperatures to slow down protein synthesis

    • Use specialized E. coli strains designed for membrane protein expression

    • Consider expression in eukaryotic systems for complex membrane proteins

  • Aggregation During Purification:

    • Solution: Include appropriate detergents throughout the purification process

    • Maintain cold temperatures during handling

    • Add stabilizing agents like glycerol or specific lipids

  • Loss of Activity After Reconstitution:

    • Solution: Carefully control the protein-to-lipid ratio during reconstitution

    • Select appropriate lipid compositions that mimic the native membrane

    • Avoid harsh conditions that might denature the protein

How can researchers troubleshoot inconsistent results in PIP2-3 functional assays?

To address inconsistent results in functional assays:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE before each experiment

    • Check for degradation products that might affect results

    • Confirm proper folding using techniques like circular dichroism

  • Assay Standardization:

    • Use positive and negative controls in each experiment

    • Standardize all buffer compositions and experimental conditions

    • Ensure consistent protein concentration determination methods

  • Environmental Factors:

    • Control temperature precisely during experiments

    • Consider the effects of pH on aquaporin activity

    • Standardize osmotic gradients in water transport assays

  • Technical Considerations:

    • Calibrate instruments regularly

    • Minimize freeze-thaw cycles of protein samples

    • Consider potential interfering factors in complex biological samples

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.