Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1 (TIP1-1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Physiology

As a tonoplast aquaporin, TIP1-1 facilitates water and small solute transport across vacuolar membranes. Key functional insights include:

Water and Hydrogen Peroxide Permeability:

  • Homologs like Arabidopsis TIP1;1 regulate vacuolar water flux and metabolite routing .

  • In yeast assays, rice TIP1-1 homologs (e.g., OsSIP1) enhance sensitivity to osmotic stressors (e.g., KCl, sorbitol), indicating water-channel activity .

Metabolite Routing:

  • Arabidopsis TIP1;1 knockdown disrupts carbohydrate metabolism, leading to starch accumulation and altered sucrose partitioning .

  • TIP1;1 in rice likely mediates vesicle-based transport between pre-vacuolar compartments and central vacuoles, analogous to its role in Arabidopsis .

Research Applications and Findings

Functional Studies:

  • Yeast Complementation: Used to validate water transport activity in aquaporin-deficient yeast strains .

  • Subcellular Localization: GFP-tagged TIP1-1 localizes to tonoplasts and vesicles in plant cells, confirmed via transient expression assays .

Expression Profiling:

  • OsTIP1;1 is constitutively expressed across rice tissues, with peak activity in roots and vascular bundles .

  • Promoter-GUS assays in transgenic rice reveal strong activity in developing tissues, suggesting roles in growth and stress response .

Comparative Analysis with Homologs

FeatureO. sativa TIP1-1Arabidopsis TIP1;1
Subcellular LocalizationTonoplast/vesicles Tonoplast/vesicles
FunctionWater transport, metabolite routingVacuolar solute partitioning
Knockdown PhenotypeNot fully characterizedDwarfism, cell death

Future Research Directions

  • Mechanistic Studies: Elucidate solute specificity (e.g., methylamine permeability observed in SIP homologs ).

  • CRISPR Knockouts: Assess phenotypic impacts on rice drought tolerance and yield.

  • Interaction Networks: Identify binding partners via yeast two-hybrid screens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
TIP1-1; YK333; Os03g0146100; LOC_Os03g05290; OsJ_009057; OSJNBa0067N01.16; Probable aquaporin TIP1-1; Tonoplast intrinsic protein 1-1; OsTIP1;1; rTIP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TIP1-1
Target Protein Sequence
MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY
Uniprot No.

Target Background

Function

Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. They may be involved in transport from the vacuolar compartment to the cytoplasm.

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Expressed in roots and leaves.

Q&A

What is the structural classification of rice TIP1-1 within the aquaporin family?

Rice TIP1-1 belongs to the Tonoplast Intrinsic Protein (TIP) subfamily of aquaporins, which is one of the four major subfamilies of plant aquaporins alongside PIPs (Plasma membrane Intrinsic Proteins), NIPs (Nodulin-26-like Intrinsic Proteins), and SIPs (Small and basic Intrinsic Proteins). Phylogenetic analyses consistently place TIP1-1 within the TIP1 subgroup, which typically contains the highly conserved NPA (Asparagine-Proline-Alanine) motif that is crucial for water selectivity and transport . Unlike SIPs, which often contain modified motifs such as NPL or NPT, TIP1-1 maintains the canonical NPA motif characteristic of most functional water channels . The TIP subfamily in plants generally subdivides into five distinct subgroups (TIP1-TIP5), with TIP1-1 featuring a conserved three-exon gene structure that distinguishes it from other aquaporin types, particularly NIPs which typically contain 4-5 exons .

How does the expression pattern of TIP1-1 vary across different rice tissues and developmental stages?

TIP1-1 demonstrates distinctive tissue-specific and developmental expression patterns in rice. Studies utilizing promoter-GUS constructs and histochemical analysis have revealed that TIP1-1 maintains consistently high background expression levels—at least ten times higher than related aquaporins like TIP1-2, TIP2-3, and PIP2-1 across various plant tissues . During flowering processes, TIP1-1 expression is significantly upregulated in rice lodicules during glume opening, indicating a potential functional role in flower development .

Expression profiling across different developmental stages shows that TIP1-1 transcript abundance increases notably from early (S1) to late (S4) flowering stages in monocots, including rice, with some species-specific variation. This pattern suggests TIP1-1 plays critical roles in water transport during reproductive development . Unlike some other aquaporins with more restricted expression domains, TIP1-1 appears to be expressed across multiple plant tissues, reflecting its fundamental importance in cellular water homeostasis.

What is known about the evolutionary conservation of TIP1-1 across plant species?

TIP1-1 exhibits remarkable evolutionary conservation across plant species, suggesting its fundamental importance in plant physiology. Comparative genomic analyses incorporating data from the OneKP database demonstrate that TIP1-1 homologs maintain high sequence conservation across diverse plant lineages, though this conservation is somewhat less pronounced than that observed in the PIP2 subfamily .

The high degree of conservation observed in TIP1-1 extends to both monocots (rice, barley, maize) and eudicots (cotton, tomato, tobacco), particularly in functional domains and motifs essential for water transport . This conservation is reflected not only in protein sequence but also in expression patterns, as TIP1-1 shows similar developmental regulation profiles during flowering processes across diverse plant species . The evolutionary stability of TIP1-1 indicates that it likely evolved early in plant evolutionary history and has maintained critical physiological functions that have been preserved through natural selection.

How does heterologous expression of rice TIP1-1 affect membrane permeability and what methodologies best assess its functional properties?

Heterologous expression systems provide crucial insights into TIP1-1 functional properties. When expressing recombinant rice aquaporins, the micro-batchwise methodology using egg-yolk phospholipids and non-polar Amberlite resin has proven effective for functional reconstitution . This approach generates proteoliposomes with good size homogeneity, as confirmed by quasi-elastic light scattering and electron microscopy analyses, which is essential for accurate functional characterization .

When assessing membrane permeability, stopped-flow light scattering techniques reveal that proteoliposomes containing functional TIP1-1 exhibit significantly higher osmotic water permeability compared to empty liposomes . The functionality of recombinant TIP1-1 can be verified through characteristic low Arrhenius activation energy measurements (approximately 3.37 kcal/mol for related aquaporins) and sensitivity to HgCl₂, a known aquaporin blocker .

What molecular mechanisms regulate TIP1-1 trafficking and post-translational modifications in rice cells?

TIP1-1 trafficking in rice cells involves complex regulatory mechanisms that affect its subcellular localization and function. While TIP1-1 predominantly localizes to the tonoplast (vacuolar membrane), studies of related aquaporins suggest that post-translational modifications significantly influence this process. S-acylation (the addition of fatty acid moieties, particularly palmitic acid, to cysteine residues) represents a crucial modification for proper membrane targeting of some plant aquaporins .

Research on Arabidopsis TIP GROWTH DEFECTIVE1 (TIP1) has demonstrated that S-acyl transferases regulate the addition of acyl groups to cysteine residues, enhancing protein hydrophobicity and membrane association . This represents a reversible modification that enables dynamic control of protein-membrane interactions. For rice TIP1-1, researchers should investigate potential S-acylation sites using predictive algorithms followed by site-directed mutagenesis and biochemical verification methods such as metabolic labeling with radiolabeled palmitic acid .

Additional regulatory mechanisms likely include phosphorylation events that modify TIP1-1 gating properties and trafficking. Research methodologies should incorporate phosphoproteomic analyses, kinase inhibitor studies, and phosphomimetic mutations to elucidate these regulatory pathways. Protein-protein interaction studies using co-immunoprecipitation or yeast two-hybrid approaches can further identify trafficking partners that facilitate TIP1-1 transport to the tonoplast.

How does TIP1-1 functionally interact with other aquaporin subfamilies in rice water transport networks?

The functional interaction between TIP1-1 and other aquaporin subfamilies creates integrated water transport networks in rice cells. While PIPs primarily facilitate water movement across the plasma membrane and TIPs regulate vacuolar water flux, their coordinated action is essential for cellular water homeostasis. Research suggests that unlike some PIP1 aquaporins (such as OsPIP1;1) that require heteromultimerization with PIP2 members to reach the plasma membrane, TIP1-1 appears capable of independent trafficking to the tonoplast .

To investigate these functional interactions, researchers should consider:

  • Generating double or triple knockout/knockdown lines targeting multiple aquaporin subfamilies

  • Conducting co-expression analyses across tissues and stress conditions

  • Performing subcellular localization studies using fluorescent protein fusions to track potential redistribution patterns

  • Measuring compartment-specific water permeability in cells with modified aquaporin expression profiles

What expression systems are optimal for producing functional recombinant rice TIP1-1?

For producing functional recombinant rice TIP1-1, Escherichia coli-based expression systems have proven effective when properly optimized. The addition of histidine tags (e.g., 10His-tag) facilitates efficient purification through affinity chromatography while minimally impacting protein functionality . When establishing an E. coli expression system, researchers should consider codon optimization for prokaryotic expression, as plant codon usage differs significantly from bacterial preferences.

For purification of functional TIP1-1:

  • Express the histidine-tagged protein in E. coli

  • Extract using appropriate detergents that maintain membrane protein integrity

  • Purify via nickel-affinity chromatography

  • Verify protein folding through circular dichroism spectroscopy

  • Incorporate into proteoliposomes using the micro-batchwise technology with egg-yolk phospholipids and non-polar Amberlite resin

Alternative expression systems include yeast (Pichia pastoris or Saccharomyces cerevisiae), which provide a eukaryotic environment that may enhance proper folding and post-translational modification. For functional studies requiring native plant modifications, plant-based transient expression systems using Nicotiana benthamiana can be valuable, though they typically yield lower protein quantities compared to microbial systems.

What analytical techniques best characterize TIP1-1 permeability properties and substrate specificity?

Comprehensive characterization of TIP1-1 permeability requires multiple complementary analytical approaches. Stopped-flow light scattering represents the gold standard for measuring osmotic water permeability in proteoliposomes . In this technique, rapid mixing of proteoliposomes with hyperosmotic solutions creates an osmotic gradient that drives water efflux, causing liposome shrinkage detectable through increased light scattering.

For substrate specificity determination:

  • Conduct comparative permeability assays using proteoliposomes containing purified TIP1-1

  • Measure permeability to water, hydrogen peroxide, glycerol, urea, and ammonia

  • Calculate Arrhenius activation energy (values below 5 kcal/mol indicate channel-mediated transport)

  • Verify channel-mediated transport using inhibitors like mercury compounds (HgCl₂)

  • Perform substrate competition assays to identify binding affinities

Advanced approaches include:

  • Patch-clamp electrophysiology on giant proteoliposomes or Xenopus oocytes expressing TIP1-1

  • Fluorescence-based transport assays using pH-sensitive or small-molecule fluorescent probes

  • Molecular dynamics simulations to predict pore size and substrate interactions

  • Site-directed mutagenesis of conserved NPA motifs and ar/R filter residues to assess their contribution to substrate selectivity

What genetic modification strategies are most effective for studying TIP1-1 function in planta?

For in planta functional studies of TIP1-1, several genetic modification approaches have proven effective. CRISPR/Cas9-mediated gene editing provides precise generation of knockout or knockdown lines, particularly valuable given the potential functional redundancy within the aquaporin family. When designing guide RNAs, researchers should target conserved functional domains while ensuring specificity to avoid off-target effects on related aquaporins.

For overexpression studies, fusion of TIP1-1 with fluorescent proteins enables simultaneous tracking of subcellular localization and expression levels. Constructs should utilize native promoters to maintain physiological expression patterns or inducible promoters for temporal control. The Agrobacterium-mediated transformation has been successfully applied for rice TIP1-1 studies, with hygromycin (50 mg L⁻¹) serving as an effective selective agent for transgenic calli screening .

For promoter analysis, GUS reporter constructs provide valuable insights into tissue-specific expression patterns. This approach requires:

  • PCR amplification of the TIP1-1 promoter region (typically 1-2 kb upstream of the start codon)

  • Cloning into appropriate expression vectors containing the GUS reporter gene

  • Agrobacterium-mediated transformation of rice calli

  • Selection of transgenic lines using appropriate antibiotics

  • Histochemical GUS assays across different tissues and developmental stages

RNA interference (RNAi) or artificial microRNA approaches offer alternatives for generating knockdown lines when complete knockout is lethal or when studying dosage effects on TIP1-1 function.

How does TIP1-1 expression correlate with drought tolerance mechanisms in rice varieties?

TIP1-1 expression demonstrates complex correlations with drought tolerance mechanisms across rice varieties. While the search results don't provide direct data on TIP1-1 drought response specifically, research on related aquaporins provides valuable insights. Aquaporins mediate cellular water flux and play critical roles in maintaining water homeostasis during water deficit conditions .

Analysis should integrate:

  • Transcriptomic data comparing TIP1-1 expression between drought-tolerant and drought-sensitive rice varieties

  • Physiological measurements of water use efficiency, stomatal conductance, and root hydraulic conductivity

  • Correlation analyses between TIP1-1 expression levels and drought tolerance metrics

Researchers must consider that aquaporin-mediated drought responses often involve coordinated regulation of multiple family members rather than isolated changes in individual genes. The high evolutionary conservation of TIP1-1 suggests its fundamental importance in water transport processes that may contribute to adaptive responses to water limitation .

What bioinformatic approaches best predict TIP1-1 structure-function relationships?

Predicting TIP1-1 structure-function relationships requires integrated bioinformatic approaches that leverage evolutionary conservation patterns. Multiple sequence alignments using tools like Dialign (http://bibiserv.techfak.uni-bielefeld.de/dialign/) enable identification of conserved motifs and functional domains across diverse plant species . Phylogenetic analyses incorporating bootstrapping (1000 repetitions) with programs like Phylo_win provide statistical confidence in evolutionary relationships that inform functional predictions .

For structural prediction:

  • Homology modeling based on crystal structures of related aquaporins

  • Molecular dynamics simulations to assess channel dynamics and water conductance

  • Analysis of conserved motifs, particularly the NPA domains and aromatic/arginine (ar/R) selectivity filter

  • Prediction of post-translational modification sites that might regulate activity

The high sequence conservation observed in TIP1-1 across plant species facilitates reliable structural predictions and identification of functionally critical residues . Researchers should particularly focus on the first NPA motif, which remains canonical in TIP1-1 unlike the modified motifs (NPT, NPC, NPL) observed in some SIP family members .

What emerging technologies show promise for advancing TIP1-1 functional studies?

Several emerging technologies demonstrate significant potential for advancing TIP1-1 functional studies:

  • Cryo-electron microscopy (Cryo-EM): While not mentioned in the search results, this technology can provide high-resolution structural insights into TIP1-1 conformation in different functional states without requiring protein crystallization.

  • Single-molecule tracking: This approach enables direct visualization of TIP1-1 trafficking and dynamics within living cells, providing spatiotemporal information about membrane localization and mobility.

  • Optogenetics: Light-controlled gating modifications to TIP1-1 would enable precise temporal control of aquaporin function, facilitating detailed studies of water transport kinetics in response to environmental stimuli.

  • Nanoscale biosensors: Development of water flux sensors with cellular or subcellular resolution would provide direct measurements of TIP1-1 activity in specific cellular compartments under diverse conditions.

  • Genome editing combined with high-throughput phenotyping: CRISPR/Cas9-based approaches creating precise TIP1-1 modifications coupled with automated phenotyping platforms can establish structure-function relationships at unprecedented scale.

These technologies, when integrated with traditional biochemical and molecular approaches, promise to significantly advance our understanding of TIP1-1 function in rice water transport networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.