Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-1 (TIP2-1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant TIP2-1 is a full-length, His-tagged aquaporin protein derived from Oryza sativa subsp. japonica (Japanese rice). It is produced in Escherichia coli (E. coli) and corresponds to residues 1–248 of the native protein (UniProt ID: Q7XA61) . Aquaporins are transmembrane channels facilitating water and small solute transport across cellular membranes, and TIP2-1 belongs to the Tonoplast Intrinsic Protein (TIP) subfamily localized in vacuolar membranes .

Functional Role in Plant Biology

TIP2-1 is essential for rice reproductive development:

  • Anther Development: TIP2 interacts with the basic helix-loop-helix (bHLH) transcription factor TDR (Tapetum Degeneration Retardation) to regulate tapetal programmed cell death (PCD). Mutations in TIP2 result in undifferentiated anther wall layers, failed microspore release, and complete male sterility .

  • Gene Regulation: TIP2 directly activates TDR and EAT1 (ETERNAL TAPETUM1), which orchestrate tapetal degradation and pollen maturation .

  • Evolutionary Conservation: Homologs of TIP2-1 in Arabidopsis thaliana and Zea mays (maize) suggest conserved roles in flowering processes and stress responses .

Production Workflow

  • Cloning: The TIP2-1 gene (LOC4330207) is cloned into expression vectors for E. coli systems .

  • Purification: Affinity chromatography via His tag ensures high yield and purity .

Research Applications

  • Mechanistic Studies: Used to dissect TIP2-1’s role in vacuolar transport and its interaction with TDR/EAT1 .

  • Antibody Production: Recombinant TIP2-1 serves as an antigen for polyclonal antibody generation (e.g., Rabbit anti-TIP2-1 IgG) .

  • Stress Response Analysis: Aquaporins like TIP2-1 are implicated in drought and salt tolerance, though direct evidence in rice requires further study .

Genetic and Phenotypic Analysis of tip2 Mutants

  • Phenotype: tip2 mutants exhibit normal vegetative growth but produce sterile pollen due to defective anther wall differentiation .

  • Genetic Interaction: TIP2 forms a regulatory cascade with TDR and EAT1, ensuring timely tapetal PCD and pollen maturation .

Future Directions

  • Stress Adaptation: Meta-analyses of RNA-seq data highlight aquaporins in drought/salt responses, but TIP2-1’s specific role warrants exploration .

  • Crop Engineering: Modulating TIP2-1 expression could enhance pollen viability or stress resilience in rice .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TIP2-1; TIP2; W950ERIPDM; Os02g0658100; LOC_Os02g44080; OJ1112_F09.18; OsJ_007553; P0519E06.48; Probable aquaporin TIP2-1; Tonoplast intrinsic protein 2-1; OsTIP2;1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TIP2-1
Target Protein Sequence
MVKLAFGSLGDSFSATSVKAYVAEFIATLLFVFAGVGSAIAYGQLTNGGALDPAGLVAIAIAHALALFVGVSVAANISGGHLNPAVTFGLAVGGHITILTGLFYWIAQLLGASIACLLLKFVTHGKAIPTHGVAGISELEGVVMEIVITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVAAGNFAGNWVYWVGPLIGGGLAGLVYGDVFIGSYQPVADQDYA
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. They may be involved in transport from the vacuolar compartment to the cytoplasm.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Expressed in roots and anthers.

Q&A

What is TIP2-1 and what is its primary function in rice plants?

TIP2-1 belongs to the tonoplast intrinsic protein family of aquaporins, primarily facilitating water transport across the tonoplast membrane in rice cells. Aquaporins are channel proteins that enable water diffusion across biological membranes and participate in all phases of plant growth and development . Similar to other plant aquaporins, TIP2-1 likely plays crucial roles in maintaining water homeostasis within plant cells, particularly in vacuolar compartments.

Methodology for investigating basic TIP2-1 function typically involves:

  • Expression analysis in different tissues using RT-PCR

  • Subcellular localization studies using fluorescent protein tags

  • Heterologous expression in systems like yeast aquaglyceroporin-mutants (fps1Δ) for functional characterization

  • Assessment of permeability to water and potentially other substrates like hydrogen peroxide

How does TIP2-1 relate to other aquaporin families in rice?

Rice contains several families of aquaporins, including plasma membrane intrinsic proteins (PIPs), tonoplast intrinsic proteins (TIPs), nodulin26-like intrinsic proteins (NIPs), and small basic intrinsic proteins (SIPs). TIP2-1 is specifically a member of the TIP family located in the tonoplast membrane.

Research indicates that the rice genome encodes other aquaporins with distinct localizations and functions. For example, OsSIP1 and OsSIP2 are predominantly located in the endoplasmic reticulum (ER) membrane, though transient localization to the plasma membrane cannot be excluded . Functional studies show that these different aquaporin families can have varied substrate specificities—OsSIP1 appears to have a wider conducting pore than OsSIP2, allowing it to facilitate permeation of water, hydrogen peroxide, and potentially methylamine .

To differentiate and characterize various aquaporin family members, researchers typically employ:

  • Phylogenetic analysis of amino acid sequences

  • Detailed subcellular localization studies

  • Substrate specificity assays in heterologous systems

  • Expression profiling across different tissues and environmental conditions

What expression systems are most effective for producing recombinant TIP2-1?

Based on available research data, E. coli has been successfully used to produce recombinant full-length rice TIP2-1 protein with His-tag modifications . For proper expression and purification of functional TIP2-1:

  • Bacterial Expression:

    • Use specialized E. coli strains optimized for membrane protein expression

    • Include affinity tags (His-tag is common) for purification purposes

    • Consider fusion partners that enhance solubility if inclusion body formation is problematic

    • Optimize induction conditions (temperature, IPTG concentration, expression time)

  • Eukaryotic Expression Systems:

    • Yeast systems may provide better membrane protein folding

    • Insect cell/baculovirus systems offer additional post-translational capabilities

    • Plant-based expression might maintain native folding and modifications

The commercial availability of "Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Aquaporin Tip2-1(Tip2-1) Protein, His-Tagged" from E. coli expression systems suggests this is a viable approach for obtaining the protein for research purposes .

How can researchers effectively assess the water transport activity of TIP2-1?

Water transport assessment for aquaporins like TIP2-1 can be approached through several methodologies:

  • Heterologous Expression Systems:

    • Yeast-based functional assays: Expression in aquaporin-deficient yeast strains can reveal TIP2-1's ability to transport water under osmotic stress conditions. This approach was successfully used with OsSIP1 and OsSIP2, where heterologous expression in yeast aquaglyceroporin-mutant fps1Δ showed increased sensitivity to osmotic challenges like KCl and sorbitol, indicating facilitated water permeation .

    • Xenopus oocyte swelling assays: This classical approach measures volume changes upon osmotic challenge in oocytes expressing the target aquaporin.

  • Reconstitution Systems:

    • Proteoliposome assays: Purified TIP2-1 can be incorporated into artificial liposomes, and water transport can be measured through light scattering techniques upon osmotic shock.

  • Cellular Systems:

    • Plant cell phenotypic analysis: Transgenic approaches altering TIP2-1 expression levels followed by cellular water relation measurements.

What approaches can be used to study TIP2-1's role in programmed cell death pathways?

TIP2-1 has been implicated in tapetum programmed cell death (PCD) pathways in rice, alongside other genes including OsiWAK1, OsPDT1, EAT1, and TDR . To investigate this role:

  • Transcriptional Regulation Analysis:

    • Dual-Luciferase (Dual-LUC) reporter assays can be employed to study the regulatory relationships between TIP2 and other transcription factors like TDR. Research has shown that TIP2 exhibits activation capacity towards the EAT1 promoter (EAT1p), with luminescence signals rising to 5.53 times that of EAT1p alone .

    • The TDR/TIP2 transcription complex shows significant synergistic effects, with co-expression increasing the luminescence signal to 17.88 times that of EAT1p . This indicates collaborative regulation of EAT1 expression, which is crucial for tapetum PCD.

  • Protein Interaction Studies:

    • Bimolecular Fluorescence Complementation (BiFC) assays can detect interactions between TIP2 and other proteins involved in PCD pathways, although research suggests that interactions between OsiWAK1-cEYFP and TIP2-nEYFP may be indirect .

    • Co-immunoprecipitation and yeast two-hybrid assays can further validate protein-protein interactions.

  • Functional Analysis:

    • RNA interference (RNAi) approaches targeting TIP2 can assess its necessity in the PCD pathway .

    • Phenotypic analysis of plants with altered TIP2 expression, focusing on pollen development and tapetum degradation.

How does TIP2-1 contribute to stress tolerance mechanisms in rice?

While direct evidence for TIP2-1's role in stress tolerance is limited in the search results, insights can be drawn from studies of other aquaporins:

  • Comparative Analysis Approach:

    • Research on KoPIP2;1 from the mangrove plant Kandelia obovata showed that overexpression in Arabidopsis significantly enhanced cold tolerance . Transgenic plants exhibited:

      • Improved growth and elevated proline content under cold stress

      • Increased superoxide dismutase (SOD) and peroxidase (POD) activities

      • Reduced malondialdehyde (MDA) content, indicating less membrane damage

    • Similar experimental approaches could be applied to investigate TIP2-1's potential role in stress responses:

      • Generate transgenic plants overexpressing or silencing TIP2-1

      • Expose to various stresses (drought, cold, salt)

      • Measure physiological parameters, osmoregulatory compounds, and antioxidant activities

  • Molecular Mechanism Investigation:

    • Assess TIP2-1's contribution to:

      • Osmoregulation through water flux control

      • Hydrogen peroxide transport (as demonstrated for OsSIP1/2 )

      • Protection of cellular membranes under stress conditions

      • Interaction with stress-responsive signaling pathways

What methodologies are most effective for studying hydrogen peroxide transport by TIP2-1?

Some aquaporins, including rice OsSIP1 and OsSIP2, have been shown to facilitate hydrogen peroxide (H₂O₂) permeation . To investigate whether TIP2-1 shares this capability:

  • Heterologous Expression Systems:

    • Express TIP2-1 in yeast cells and assess H₂O₂ sensitivity. For OsSIP1 and OsSIP2, expression in yeast aquaglyceroporin-mutant fps1Δ made cells more sensitive to H₂O₂, indicating facilitated permeation .

    • Similar approaches could determine if TIP2-1 possesses comparable H₂O₂ transport capabilities.

  • Molecular Approaches:

    • Site-directed mutagenesis of pore-lining residues to identify determinants of H₂O₂ selectivity

    • Structural modeling to predict substrate specificity based on pore architecture

    • Comparative analysis with known H₂O₂-transporting aquaporins

  • In Planta Studies:

    • H₂O₂ imaging in plant cells with altered TIP2-1 expression

    • Assessment of oxidative stress responses in TIP2-1 mutants or transgenic plants

    • Investigation of H₂O₂-dependent signaling pathways

How can researchers effectively study the interactions between TIP2-1 and transcription factors in rice?

The search results reveal that TIP2 interacts functionally with transcription factor TDR to regulate EAT1 expression . To further investigate such interactions:

  • Reporter Gene Assays:

    • The Dual-Luciferase (Dual-LUC) assay has proven effective for detecting the synergistic impact of TDR and TIP2 on EAT1p activation . This methodology allows quantitative assessment of transcriptional activation.

    • Results showed that while TDR and TIP2 individually activate EAT1p to 1.83 and 5.53 times baseline levels respectively, together they increase activation to 17.88 times baseline, demonstrating their collaborative regulation .

  • Protein-Protein Interaction Studies:

    • BiFC assays can visualize interactions in plant cells, though results suggest that some interactions (like those between OsiWAK1 and TIP2) may be indirect .

    • Other approaches include co-immunoprecipitation, pull-down assays, and yeast two-hybrid screens.

  • Functional Validation:

    • RNA interference (RNAi) constructs targeting TIP2 can assess its necessity in transcriptional regulation .

    • ChIP-seq or ChIP-qPCR to identify direct binding sites of transcription factors on target gene promoters

    • Genetic approaches combining mutations in multiple pathway components

What are the key considerations when designing expression constructs for recombinant TIP2-1?

Based on research experiences with aquaporins and available commercial constructs:

  • Vector Selection and Tags:

    • For E. coli expression, vectors with strong promoters (T7, tac) are commonly used

    • His-tags facilitate purification via IMAC and are commonly employed with TIP2-1

    • Gateway technology has been successfully used for cloning aquaporin genes, as demonstrated with KoPIP2;1

    • Consider tag position (N- vs C-terminal) based on structural knowledge to minimize functional interference

  • Important Design Elements:

    • Codon optimization for the expression host

    • Signal sequences appropriate for the target membrane

    • Inclusion of protease cleavage sites for tag removal if needed

    • Careful consideration of restriction sites and fusion protein boundaries

  • Control Constructs:

    • Include appropriate controls for subcellular localization studies

    • Consider truncation constructs for domain-specific analyses

    • Design constructs compatible with multiple experimental applications

What data analysis approaches should be used when interpreting TIP2-1 functional studies?

For rigorous analysis of TIP2-1 functional data:

  • Transport Activity Analysis:

    • Calculate water permeability coefficients (Pf) from swelling/shrinking assays

    • Determine activation energies to distinguish between channel-mediated and diffusion-based transport

    • Apply appropriate kinetic models for substrate transport analysis

    • Consider control experiments with inhibitors like mercury compounds

  • Expression and Localization Data:

    • Use appropriate normalization for qRT-PCR data

    • Apply statistical analysis for comparing expression levels between tissues/conditions

    • For microscopy data, employ quantitative colocalization analysis with compartment markers

    • Consider dynamics of protein trafficking between compartments

  • Interaction Studies:

    • For Dual-LUC assays, normalize firefly luciferase activity to Renilla luciferase internal control

    • Apply appropriate statistical tests for interaction data analysis

    • Consider dose-dependency and competition experiments for validation

How can TIP2-1 research contribute to rice improvement strategies?

TIP2-1 research has potential applications in rice improvement:

  • Stress Tolerance Enhancement:

    • Similar to how KoPIP2;1 overexpression enhanced cold tolerance in Arabidopsis , modulation of TIP2-1 expression might improve rice response to environmental stresses

    • This approach could be particularly valuable as water use is an important factor affecting rice growth and development

  • Reproductive Development Optimization:

    • Given TIP2's role in tapetum programmed cell death and pollen development , manipulating its expression or activity might improve reproductive success under adverse conditions

    • Fine-tuning TDR/TIP2 transcriptional complex activity could potentially enhance rice fertility

  • Water Use Efficiency Improvement:

    • As an aquaporin involved in cellular water transport, TIP2-1 may influence whole-plant water relations

    • Targeted modifications might enhance water use efficiency, a critical trait for sustainable rice production

What are the most pressing research gaps regarding TIP2-1 function in rice?

Current knowledge gaps that warrant investigation include:

  • Structural Determinants of Function:

    • Detailed structural characterization of TIP2-1's substrate selectivity filter

    • Identification of post-translational modification sites affecting transport activity

    • Comparison with other TIP family members to understand functional specialization

  • Physiological Roles:

    • Tissue-specific functions beyond reproduction

    • Developmental regulation throughout the rice life cycle

    • Response patterns under various biotic and abiotic stresses

  • Regulatory Networks:

    • Transcriptional and post-translational regulation mechanisms

    • Integration with hormone signaling pathways

    • Interactions with other membrane proteins in the tonoplast

Table 1: Comparison of Rice Aquaporins Based on Available Research Data

AquaporinSubcellular LocalizationSubstrate SpecificityKey FunctionsSize (amino acids)
TIP2-1TonoplastWater (predicted)Tapetum programmed cell death 248
OsSIP1Endoplasmic reticulumWater, H₂O₂, methylamineWater homeostasis, possibly stress response Not specified
OsSIP2Endoplasmic reticulumWater, H₂O₂Water homeostasis, possibly stress response Not specified
KoPIP2;1*Plasma membraneWaterEnhanced cold tolerance, increased antioxidant capacity 283

*KoPIP2;1 is from mangrove plant Kandelia obovata, included for comparative reference

Table 2: Methodological Approaches for TIP2-1 Functional Analysis

Research ObjectiveRecommended MethodologiesKey ParametersRelevant Controls
Water transport activityYeast complementation assays, oocyte swelling, proteoliposome shrinkageOsmotic gradient magnitude, temperature, pHAQP inhibitors (e.g., HgCl₂), non-functional mutants
H₂O₂ transportYeast sensitivity assays, fluorescent H₂O₂ probesH₂O₂ concentration, exposure timeNon-permeable aquaporins, catalase treatment
Transcriptional regulationDual-Luciferase reporter assaysPromoter length, co-factor presenceEmpty vector, mutated binding sites
Protein interactionsBiFC, co-immunoprecipitation, yeast two-hybridExpression levels, fusion protein orientationNegative interaction controls
Stress response analysisTransgenic overexpression/silencingStress type, duration, recovery periodWild-type plants, empty vector transformants

Table 3: Expression Construct Design for Recombinant TIP2-1 Production

Expression SystemVector TypeTag OptionSpecial ConsiderationsApplication
E. colipET seriesHis-tag (N or C terminal) Codon optimization, specialized strains for membrane proteinsProtein purification for biochemical studies
Gateway systempGWB505GFP fusionCompatible with plant transformationIn planta localization studies
Dual-LuciferaseMini35SpTranscription factor fusionOptimize promoter-reporter pairingTranscriptional activity studies
BiFC systemSplit-YFP vectorsYFP fragment fusion (cEYFP/nEYFP)Proper orientation to prevent steric hindranceProtein interaction studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.