Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP2-2 (TIP2-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TIP2-2; Os06g0336200; LOC_Os06g22960; OsJ_020360; OSJNBa0012F14.45-1; P0427E01.5-1; Probable aquaporin TIP2-2; Tonoplast intrinsic protein 2-2; OsTIP2;2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TIP2-2
Target Protein Sequence
MSGNIAFGRFDDSFSAASLKAYVAEFISTLVFVFAGVGSAIAYTKLTGGAPLDPAGLVAVAVCHGFGLFVAVAIGANISGGHVNPAVTFGLALGGQITILTGVFYWIAQLLGAIVGAVLVQFCTGVATPTHGLSGVGAFEGVVMEIIVTFGLVYTVYATAADPKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVASGDYTNIWIYWVGPLVGGGLAGLVYRYVYMCGDHAPVASSEF
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. They may be involved in the transport of substances from the vacuolar compartment to the cytoplasm.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Expressed in roots and leaves.

Q&A

What is OsPIP2;2 and how is it classified within the aquaporin family?

OsPIP2;2 is a member of the PLASMA MEMBRANE INTRINSIC PROTEIN (PIP) family of aquaporins found in rice (Oryza sativa). The PIP family in rice consists of 11 members, categorized into two subfamilies: OsPIP1;1 to OsPIP1;3, and OsPIP2;1 to OsPIP2;8. These proteins are hypothesized to facilitate the transport of water and other small compounds across cell membranes. Among these, OsPIP2;2 has been characterized as the most efficient facilitator of water transport when compared to the other 10 OsPIPs in rice . Aquaporins like OsPIP2;2 form part of a larger major intrinsic protein family that includes other subfamilies such as the tonoplast intrinsic proteins (TIPs), which are distinct in their subcellular localization and sometimes in their substrate selectivity profiles.

How does OsPIP2;2 expression change under stress conditions?

Under physiological drought stress conditions, four PIP genes (OsPIP1;3, OsPIP2;1, OsPIP2;2, and OsPIP2;4) show induced expression in rice plant leaves, with OsPIP2;2 exhibiting the highest expression level among them . This upregulation suggests a critical role for OsPIP2;2 in the plant's response to water limitation. Additionally, OsPIP2;2 is strongly induced by pathogen infection, indicating its dual functionality in both abiotic and biotic stress responses . The temporal and spatial expression patterns of OsPIP2;2 provide valuable insights into its functional significance in plant stress adaptation mechanisms, with evidence suggesting that its increased expression correlates with enhanced drought tolerance and pathogen resistance in rice.

What cellular localizations have been confirmed for OsPIP2;2?

OsPIP2;2 has been confirmed to localize to the plasma membrane in plant cells. Studies involving heterologous expression systems, including frog oocytes and yeast cells, have demonstrated that OsPIP2;2 correctly targets to the plasma membrane where it forms functional oligomeric structures, specifically trimers and tetramers . This plasma membrane localization is consistent with its role in facilitating water and small molecule transport between the cell and its external environment. The proper subcellular targeting of OsPIP2;2 is essential for its physiological functions, allowing it to mediate water flux across the cell boundary and participate in signaling pathways involved in stress responses.

What techniques are commonly used to study OsPIP2;2 localization?

Researchers commonly employ several techniques to study OsPIP2;2 localization:

  • Heterologous expression systems: OsPIP2;2 has been expressed in frog oocytes and yeast cells for localization studies .

  • Fluorescent protein tagging: Fusion of OsPIP2;2 with fluorescent proteins allows visualization of its subcellular distribution using confocal microscopy.

  • Immunolocalization: Using specific antibodies against OsPIP2;2 for immunofluorescence studies.

  • Subcellular fractionation: Isolating plasma membrane fractions followed by Western blotting to detect OsPIP2;2.

  • Protoplast transformation: Expression of OsPIP2;2 in tobacco and rice protoplasts has been used to study its localization and function .

These complementary approaches provide robust evidence for the plasma membrane localization of OsPIP2;2 and its organization into functional oligomeric structures.

How does OsPIP2;2 mechanistically contribute to drought tolerance in rice?

OsPIP2;2 contributes to drought tolerance through multiple mechanisms. As the most efficient water transport facilitator among rice PIPs, it enhances membrane permeability to water, helping to maintain cellular water homeostasis under water-limited conditions . OsPIP2;2-mediated water transport is accompanied by specific drought-tolerant responses, including increased concentrations of proline and polyamines, which are established physiological markers of drought tolerance . Furthermore, OsPIP2;2 plays a critical role in maintaining cell membrane integrity during drought stress, effectively protecting rice cells from electrolyte leakage caused by physiological drought stress . At the molecular level, overexpression of OsPIP2;2 enhances the expression of drought tolerance pathway marker genes, while gene silencing strongly inhibits these responses. This multifaceted contribution to drought tolerance highlights OsPIP2;2 as a key target for improving rice resilience to water-limited conditions.

How can researchers quantitatively assess OsPIP2;2-mediated water transport activity?

Researchers can quantitatively assess OsPIP2;2-mediated water transport activity through several experimental approaches:

  • Oocyte swelling assays: After expressing OsPIP2;2 in Xenopus laevis oocytes, researchers can measure osmotic water permeability (Pf) by tracking volume changes upon exposure to hypoosmotic solutions .

  • Yeast growth complementation: Evaluating growth recovery of yeast mutants defective in water transport when complemented with OsPIP2;2.

  • Protoplast swelling/shrinking kinetics: Measuring the rate of volume change in plant protoplasts expressing OsPIP2;2 when subjected to osmotic challenges .

  • Stopped-flow spectroscopy: Monitoring the kinetics of water movement across protoplast or vesicle membranes containing OsPIP2;2.

  • Cell pressure probe measurements: Directly measuring hydraulic conductivity in cells expressing OsPIP2;2.

Each method provides complementary information on water transport efficiency, with the oocyte and protoplast systems being particularly valuable for comparing OsPIP2;2 activity to other aquaporins under standardized conditions.

What is the relationship between OsPIP2;2 phosphorylation and its water transport activity?

Phosphorylation represents a key regulatory mechanism for OsPIP2;2 activity. Research has shown that OsPIP2;2 undergoes phosphorylation at specific serine residues, including S125, which significantly impacts its transport capabilities . While this phosphorylation was initially identified in the context of pathogen response and H₂O₂ transport, similar post-translational modifications likely regulate water transport activity as well. Phosphorylation may affect OsPIP2;2 function through multiple mechanisms: altering protein conformation, regulating channel gating, influencing protein-protein interactions, or affecting subcellular trafficking and membrane insertion. The phosphorylation status of OsPIP2;2 may serve as a molecular switch that allows plants to rapidly adjust water permeability in response to changing environmental conditions, particularly during drought stress when fine-tuned water transport becomes critical for cellular survival.

How does OsPIP2;2 compare functionally with other OsPIPs in drought response?

Among the 11 OsPIP family members, OsPIP2;2 stands out as the most efficient facilitator of water transport across cell membranes based on comparative functional studies . When expressed in frog oocytes, yeast cells, and tobacco protoplasts, OsPIP2;2 demonstrated superior ability to support water import compared to other drought-responsive aquaporins including OsPIP1;3, OsPIP2;1, and OsPIP2;4 . This functional superiority suggests that OsPIP2;2 plays a predominant role in facilitating water movement during drought stress conditions.

The following table summarizes the comparative functional analysis of drought-responsive OsPIPs:

OsPIP MemberDrought InductionRelative Water Transport EfficiencyRole in Drought Response
OsPIP2;2HighHighestPrimary facilitator
OsPIP2;1ModerateModerateSupportive role
OsPIP2;4ModerateModerateSupportive role
OsPIP1;3ModerateLowerComplementary function

These functional differences highlight the specialized role of OsPIP2;2 in the orchestrated drought response of rice plants and suggest that targeted enhancement of OsPIP2;2 activity might be particularly beneficial for improving drought tolerance.

How can researchers accurately measure OsPIP2;2-mediated H₂O₂ transport?

Measuring OsPIP2;2-mediated H₂O₂ transport requires specialized techniques that can detect the movement of reactive oxygen species across membranes. Researchers can employ several methodologies:

  • H₂O₂-sensitive fluorescent probes: Using probes like H₂DCFDA or PF6-AM that become fluorescent upon reaction with H₂O₂ in heterologous expression systems like yeast or in plant protoplasts expressing OsPIP2;2.

  • Genetically encoded H₂O₂ sensors: Employing HyPer or roGFP2-Orp1 fusion proteins to detect H₂O₂ flux in real-time with subcellular resolution.

  • Amplex Red assays: Quantifying H₂O₂ concentration changes in different cellular compartments to track transport.

  • Patch-clamp electrophysiology: Measuring currents associated with H₂O₂ movement through OsPIP2;2 channels.

  • Respiration-based assays: In yeast systems, measuring oxygen consumption rates as an indirect measure of H₂O₂ detoxification following transport.

These approaches can be calibrated using OsPIP2;2 mutants with impaired H₂O₂ transport capabilities or through pharmacological inhibition of aquaporin function to establish specificity .

What genetic tools have been developed to study OsPIP2;2 function in pathogen response?

Several genetic tools have been developed to study OsPIP2;2 function in pathogen response:

  • CRISPR/Cas9-generated knockout lines: Two representative homozygous mutant lines (Ospip2;2#41 and Ospip2;2#279) have been created. The Ospip2;2#41 line contains a T insertion causing a frameshift in OsPIP2;2, while Ospip2;2#279 has a point mutation and three nucleotide deletions .

  • Overexpression lines: Two independent OsPIP2;2 overexpression lines (OsPIP2;2OE#1 and OsPIP2;2OE#2) have been established to study gain-of-function effects .

  • Phosphorylation site mutants: Researchers have created OsPIP2;2 variants with mutations at phosphorylation sites like S125 to study the impact on H₂O₂ transport and pathogen response.

  • Promoter-reporter constructs: These tools help monitor OsPIP2;2 expression patterns during pathogen infection.

  • RNA interference constructs: For transient or stable silencing of OsPIP2;2 to assess its necessity in pathogen response.

These genetic resources provide powerful means to dissect the specific contributions of OsPIP2;2 to pathogen resistance in rice.

How can researchers assess the role of OsPIP2;2 in plant immunity pathways?

Researchers can assess the role of OsPIP2;2 in plant immunity through multiple complementary approaches:

  • Pathogen challenge assays: Inoculating OsPIP2;2 mutant, overexpression, and wild-type plants with pathogens like Xanthomonas oryzae pv. oryzae (Xoo), X. oryzae pv. oryzicola (Xoc), or Magnaporthe oryzae to measure disease progression through lesion length and bacterial titers .

  • MAPK activation analysis: Monitoring the phosphorylation status of MAP kinases after treatment with microbial elicitors like flg22 in plants with altered OsPIP2;2 expression .

  • Defense gene expression profiling: Quantifying expression of defense-related genes in response to pathogen challenge in OsPIP2;2 variants.

  • Reactive oxygen species measurement: Tracking H₂O₂ production and localization during pathogen attack using histochemical staining (DAB) or fluorescent probes.

  • Transcription factor translocation assays: Following the movement of immunity-related transcription factors like OsmaMYB from the plasma membrane to the nucleus in response to pathogen elicitors .

These methodologies collectively provide a comprehensive view of how OsPIP2;2 influences multiple facets of the plant immune response.

What is the relationship between OsPIP2;2 phosphorylation and transcription factor dynamics?

OsPIP2;2 phosphorylation serves as a molecular switch that links pathogen perception to transcriptional reprogramming through an elegant mechanism involving membrane-anchored transcription factors. When rice plants detect pathogens, OsPIP2;2 becomes phosphorylated at serine residue S125, which enhances its ability to transport H₂O₂ . This phosphorylation event also triggers the translocation of OsmaMYB, a membrane-anchored MYB transcription factor, from the plasma membrane into the nucleus . In the nucleus, OsmaMYB activates the expression of defense-related genes that contribute to pathogen resistance.

This mechanism appears to be conserved across plant species, as similar interactions have been observed in roses (Rosa hybrida) under drought stress, where the phosphorylation of RhPIP2;1 promotes the nuclear accumulation of RhPTM (a membrane-anchored MYB transcription factor) . The OsPIP2;2-OsmaMYB pathway represents a direct link between membrane signaling events and nuclear transcriptional responses, providing plants with a rapid and efficient means to activate defense programs upon pathogen detection.

What expression systems are optimal for producing recombinant OsPIP2;2?

Several expression systems have been evaluated for producing recombinant aquaporins, with varying degrees of success applicable to OsPIP2;2 research:

The choice of expression system should be guided by the specific research questions, required protein yield, and downstream applications.

What are the critical controls needed when studying OsPIP2;2 transport activity?

When studying OsPIP2;2 transport activity, researchers should implement several critical controls:

  • Substrate specificity controls:

    • Water-only transport measurements compared to H₂O₂ transport

    • Size-exclusion experiments with molecules of different dimensions

    • Transport assays with structurally similar but functionally distinct molecules

  • Genetic controls:

    • OsPIP2;2 knockout/mutant lines (e.g., Ospip2;2#41, Ospip2;2#279)

    • Empty vector/wild-type controls for heterologous expression

    • Complementation lines to verify phenotype rescue

  • Pharmacological controls:

    • Aquaporin inhibitors (e.g., mercury compounds, silver ions)

    • Specific inhibitors of signaling pathways involved in OsPIP2;2 regulation

    • H₂O₂ scavengers when studying ROS transport

  • Phosphorylation status controls:

    • Phospho-mimetic mutants (e.g., S125D)

    • Phospho-null mutants (e.g., S125A)

    • Treatments with kinase inhibitors

  • Experimental condition controls:

    • Osmotic controls for water transport experiments

    • H₂O₂ concentration gradients for ROS transport studies

    • Membrane integrity verification

These controls help establish specificity, validate the functional attributions to OsPIP2;2, and distinguish between direct and indirect effects on transport phenomena.

How can researchers differentiate between direct and indirect effects of OsPIP2;2 on stress responses?

Differentiating between direct and indirect effects of OsPIP2;2 on stress responses requires a multifaceted experimental approach:

  • Temporal resolution studies:

    • High-resolution time-course experiments to establish causality

    • Real-time measurements of water or H₂O₂ transport followed by stress response markers

    • Inducible expression systems to temporally control OsPIP2;2 activity

  • Spatial organization analysis:

    • Cell-specific or tissue-specific expression of OsPIP2;2

    • Subcellular targeting variants to distinguish plasma membrane-specific effects

    • Co-localization studies with stress response components

  • Protein interaction studies:

    • Co-immunoprecipitation to identify direct interaction partners

    • Split-ubiquitin or split-GFP assays for membrane protein interactions

    • Identification of OsPIP2;2 interaction with signaling components like OsmaMYB

  • Transport-deficient variants:

    • OsPIP2;2 mutants that maintain structure but lose transport function

    • Separation of water transport from H₂O₂ transport capabilities

    • Correlation between transport activity and stress response magnitude

  • Bypass experiments:

    • Artificial induction of downstream stress responses in OsPIP2;2 mutants

    • Introduction of alternative transport pathways to compensate for OsPIP2;2 deficiency

    • Parallel activation of multiple stress response pathways

These approaches collectively help establish which aspects of stress adaptation are directly attributable to OsPIP2;2 transport activities versus secondary effects.

What are the challenges in purifying functional recombinant OsPIP2;2?

Purifying functional recombinant OsPIP2;2 presents several challenges specific to membrane proteins:

  • Membrane extraction efficiency:

    • Selection of appropriate detergents that solubilize OsPIP2;2 without denaturing it

    • Optimization of detergent-to-protein ratios

    • Maintenance of the oligomeric state (trimers/tetramers) during extraction

  • Protein stability issues:

    • Prevention of aggregation during purification

    • Maintenance of native conformation in detergent micelles

    • Long-term stability during storage and experimental procedures

  • Functional verification:

    • Development of activity assays compatible with purified protein

    • Reconstitution into proteoliposomes to verify transport function

    • Structural integrity confirmation via circular dichroism or other spectroscopic methods

  • Post-translational modifications:

    • Preservation or recapitulation of critical phosphorylation sites like S125

    • Analysis of other modifications that might affect function

    • Selection of expression systems that properly introduce required modifications

  • Scale-up challenges:

    • Transitioning from analytical to preparative scale

    • Consistency across purification batches

    • Cost-effectiveness of the purification process

Addressing these challenges requires optimization at each step of the expression and purification process, often necessitating a combination of approaches tailored to the specific properties of OsPIP2;2.

What are the unresolved questions about OsPIP2;2 regulatory mechanisms?

Several critical questions about OsPIP2;2 regulatory mechanisms remain unresolved:

  • Regulatory network complexity:

    • How is OsPIP2;2 expression coordinated with other aquaporins during multiple simultaneous stresses?

    • What transcription factors directly regulate OsPIP2;2 expression under different stress conditions?

    • How do epigenetic mechanisms contribute to OsPIP2;2 regulation during stress and recovery?

  • Post-translational regulation:

    • Beyond S125 phosphorylation, what other post-translational modifications affect OsPIP2;2 function?

    • What kinases and phosphatases specifically target OsPIP2;2 during different stress responses?

    • How is OsPIP2;2 protein stability and turnover regulated under various conditions?

  • Subcellular trafficking:

    • What mechanisms control OsPIP2;2 insertion into and retrieval from the plasma membrane?

    • How is OsPIP2;2 trafficking connected to vesicular transport and endomembrane systems?

    • What endocytic and recycling pathways regulate OsPIP2;2 abundance at the cell surface?

  • Channel gating mechanisms:

    • What molecular events trigger channel opening and closing in response to stress signals?

    • How do interactions with other proteins modulate OsPIP2;2 channel gating?

    • What is the structural basis for differential transport of water versus H₂O₂?

  • Cross-talk with hormonal pathways:

    • How do stress hormones like ABA modulate OsPIP2;2 function during drought?

    • What is the interplay between salicylic acid signaling and OsPIP2;2 during pathogen response?

    • How do growth hormones affect OsPIP2;2 expression and activity?

Addressing these questions will require integrated approaches combining structural biology, advanced imaging, systems biology, and in vivo functional studies.

How might OsPIP2;2 research contribute to improving stress resilience in rice?

OsPIP2;2 research offers several promising avenues for improving stress resilience in rice:

  • Enhanced drought tolerance strategies:

    • Development of rice varieties with optimized OsPIP2;2 expression patterns

    • Engineering of OsPIP2;2 variants with improved water transport efficiency

    • Identification of compounds that specifically modulate OsPIP2;2 activity during water limitation

  • Improved disease resistance approaches:

    • Creation of rice lines with enhanced pathogen-responsive OsPIP2;2 expression

    • Engineering of OsPIP2;2 variants with optimized H₂O₂ transport capabilities

    • Development of strategies to activate the OsPIP2;2-OsmaMYB immune signaling pathway

  • Multiple stress resilience:

    • Understanding how OsPIP2;2 balances its dual roles in drought and pathogen responses

    • Engineering plants with stress-specific regulation of OsPIP2;2 phosphorylation

    • Development of crops with optimized water use efficiency without compromised immune function

  • Precision agriculture applications:

    • Using OsPIP2;2 expression as a biomarker for early stress detection

    • Developing field-applicable methods to monitor OsPIP2;2 activity

    • Creating targeted interventions that specifically modulate OsPIP2;2 function

  • Biotechnological applications:

    • Using OsPIP2;2 in biomimetic membranes for water purification

    • Developing OsPIP2;2-based biosensors for environmental monitoring

    • Exploring OsPIP2;2 as a delivery system for agricultural compounds

These applications highlight the translational potential of fundamental research on OsPIP2;2 structure and function.

What emerging technologies could advance OsPIP2;2 functional characterization?

Several emerging technologies offer promising approaches for advancing OsPIP2;2 functional characterization:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for high-resolution structure determination of OsPIP2;2 in different conformational states

    • Single-particle analysis to capture dynamic changes during transport

    • Computational molecular dynamics simulations to model water and H₂O₂ transport through OsPIP2;2 channels

  • Single-molecule approaches:

    • Patch-clamp techniques adapted for single-channel measurements of OsPIP2;2

    • Single-molecule FRET to monitor conformational changes during transport

    • Super-resolution microscopy to track individual OsPIP2;2 molecules in living cells

  • Advanced '-omics' integration:

    • Spatial transcriptomics to map OsPIP2;2 expression patterns with subcellular resolution

    • Phosphoproteomics to comprehensively identify stress-induced modification sites

    • Interactomics to define the complete OsPIP2;2 protein interaction network

  • Genome editing advancements:

    • Prime editing for precise modification of OsPIP2;2 regulatory elements

    • Base editing for creating specific amino acid substitutions

    • Optogenetic regulation of OsPIP2;2 expression or activity

  • Synthetic biology approaches:

    • Designer OsPIP2;2 variants with novel transport properties

    • Orthogonal regulatory systems for precise control of OsPIP2;2 function

    • Engineered cellular contexts to isolate and study specific aspects of OsPIP2;2 function

These technologies, particularly when used in combination, have the potential to resolve longstanding questions about OsPIP2;2 function and regulation at unprecedented levels of detail.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.