Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP4-3 (TIP4-3)

Shipped with Ice Packs
In Stock

Description

Genomic and Evolutionary Context

TIP4-3 is part of a conserved aquaporin lineage in Oryza species:

  • Subfamily Specificity: TIP aquaporins are tonoplast-localized, facilitating vacuolar water flux and stress adaptation .

  • Gene Structure: Contains 2–3 exons, a hallmark of TIP subfamily members, with motifs linked to transmembrane transport .

  • Evolutionary Conservation: Strong purifying selection observed across Oryza genomes, indicating functional indispensability .

  • Regulatory Elements: Promoter regions harbor cis-acting elements responsive to phytohormones (e.g., abscisic acid) and abiotic stresses (e.g., drought) .

Functional Roles in Rice Physiology

TIP4-3 contributes to:

  • Osmoregulation: Mediates water uptake into vacuoles, maintaining cell turgor during drought or salinity .

  • Stress Responses: Transcript levels are modulated by phytohormones (auxin, jasmonate) and stressors (cold, osmotic shock) .

  • Nutrient Transport: Potential role in mobilizing solutes like ammonia or urea, though substrate specificity requires validation .

Expression Systems

HostYieldApplicationsReferences
E. coliHighStructural studies, antibody production
Mammalian CellsModerateFunctional assays, membrane protein analysis
Cell-Free ExpressionLowRapid prototyping of mutants

Research Tools

  • Antibodies: Rabbit polyclonal antibodies (IgG) against TIP4-3 enable Western blot and ELISA applications .

  • Mutant Lines: CRISPR-edited TIP4-3 knockout rice lines are used to study phenotypic impacts on stress tolerance .

Key Research Findings

  • Haplotype Analysis: Superior haplotypes of TIP4-3 orthologs correlate with enhanced grain yield under drought in indica-japonica hybrids .

  • Expression Dynamics: TIP4-3 transcripts are upregulated in roots under osmotic stress, suggesting tissue-specific regulation .

  • Protein Interactions: Co-expresses with sucrose synthase (OsSUS3), implicating it in carbohydrate partitioning .

Future Research Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to elucidate pore architecture.

  • Crop Engineering: Overexpression of TIP4-3 in drought-sensitive rice cultivars to enhance resilience.

  • Substrate Profiling: Determine whether TIP4-3 transports non-aqueous molecules (e.g., H2O2, CO2).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate with us, and we will prioritize developing the specified tag.
Synonyms
TIP4-3; Os01g0232000; LOC_Os01g13120; P0431F01.24; Probable aquaporin TIP4-3; Tonoplast intrinsic protein 4-3; OsTIP4;3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TIP4-3
Target Protein Sequence
MAKLALGHHREATDPGCLRAVVAELLLTFLFVFSGVGSAMAAAKLGGGGDTIMGLTAVAAAHALVVAVMVSAGLHVSGGHINPAVTLGLAAGGHITLFRSALYAAAQLLGSSLACLLLAALTGGEEAVPVHAPAPGVGAARAVAMEAVLTFSLLFAVYATVVDRRRAVGALGPLLVGLVVGANILAGGPYSGASMNPARSFGPALAAGEWADHWIYWVGPLIGGPLAGLVYEGLFMGPPGHEPLPRNDGDF
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. They may be involved in transport from the vacuolar compartment to the cytoplasm.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, TIP (TC 1.A.8.10) subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.
Tissue Specificity
Expressed in leaves.

Q&A

What is TIP4-3 and how is it classified within the aquaporin family?

TIP4-3 (Tonoplast Intrinsic Protein 4-3) is a member of the aquaporin family found in rice (Oryza sativa subsp. japonica). Aquaporins are membrane proteins that facilitate water transport across cellular membranes. Within the aquaporin superfamily, TIP4-3 belongs to the Tonoplast Intrinsic Protein (TIP) subfamily, which primarily localizes to the vacuolar membrane. Phylogenetic analysis places TIP4-3 in the TIP4 subgroup, which represents one of the basal subgroups of the TIP family alongside TIP2 and TIP3 . The TIP4 subfamily evolved as part of the substantial proliferation of aquaporins that occurred during land plant evolution, with significant expansion originating in early land plant ancestors after divergence from ferns .

What is the protein structure and sequence length of rice TIP4-3?

According to product information data, the full-length recombinant Oryza sativa subsp. japonica TIP4-3 protein consists of 251 amino acids (residues 1-251) . Like other aquaporins, TIP4-3 likely contains six transmembrane domains connected by five loops, with both N and C termini located on the cytoplasmic side of the membrane. The protein contains the characteristic NPA (Asparagine-Proline-Alanine) motifs that form the water-selective pore, though specific motif analysis for TIP4-3 is not detailed in the provided search results.

How does TIP4-3 compare structurally to other TIP subfamily members?

While the search results don't provide specific comparative structural information for TIP4-3, insights can be drawn from related TIP proteins. Evolutionary analysis of aquaporins shows that TIP proteins across plant species contain highly conserved motifs that are essential for their function . For example, TIP2;3 exhibits evolutionary conservation across diverse plant lineages from algae to angiosperms, with preserved functional domains . This conservation pattern suggests that TIP4-3 likely maintains similar core structural elements while potentially having subfamily-specific variations that determine its specific subcellular localization and substrate selectivity.

How can researchers effectively analyze TIP4-3 expression in response to environmental stresses?

Based on methods used for other rice aquaporins, an effective protocol for analyzing TIP4-3 expression under stress conditions would include:

  • Subject rice plants to controlled stress conditions (e.g., salt, drought, ABA treatment)

  • Harvest tissue samples at multiple time points (e.g., 0, 3, 6, 12, 24, 48 hours)

  • Extract total RNA and synthesize cDNA

  • Perform quantitative RT-PCR using TIP4-3-specific primers

  • Normalize expression data against stable reference genes

  • Analyze temporal expression patterns

This approach mirrors that used for OsPIP genes, which revealed diverse expression responses to salt, drought, and ABA treatments . Such analysis would help determine whether TIP4-3 is involved in stress responses similar to other aquaporins that show altered expression under abiotic stresses.

What methods are recommended for functional characterization of recombinant TIP4-3?

For functional characterization of recombinant TIP4-3, researchers should consider the following methodological approach:

  • Heterologous expression systems: Express His-tagged TIP4-3 in E. coli (as available commercially ) or alternative systems such as Xenopus oocytes or yeast.

  • Water permeability assays: For oocyte-expressed TIP4-3, use swelling assays in hypotonic solutions to measure water transport capability. For yeast or E. coli systems, employ stopped-flow spectrophotometry to measure changes in cell volume upon osmotic shock.

  • Substrate specificity testing: Evaluate transport of potential substrates beyond water (e.g., small neutral solutes, hydrogen peroxide) using radioactively labeled compounds or fluorescent indicators.

  • Functional complementation: Express TIP4-3 in aquaporin-deficient yeast or plant mutants to assess its ability to rescue phenotypes.

  • Structure-function analysis: Create site-directed mutants of conserved residues to identify domains critical for transport activity.

This comprehensive approach would provide robust insights into TIP4-3's function and specificity, similar to analyses performed for other plant aquaporins.

How conserved is TIP4-3 across different plant species?

The evolutionary conservation of TIP4-3 reflects patterns observed in related TIP subfamilies. TIP subfamilies show substantial conservation across land plants, with significant expansion occurring during the transition from aquatic to terrestrial environments . While specific analysis of TIP4-3 conservation is not detailed in the search results, related TIP proteins (TIP1;1, TIP1;2, TIP2;3) show high evolutionary conservation across both monocots and eudicots, playing important roles in flowering processes .

TIP4 represents one of the basal subgroups of aquaporins, alongside TIP2 and TIP3, with subsequent expansion occurring in seed plant ancestors like Lycopodiophyta and Bryophyta after divergence from ferns . The conservation of these proteins throughout plant evolution highlights their essential functions in water transport and plant physiology.

What phylogenetic analysis techniques are most appropriate for studying TIP4-3 evolution?

Based on approaches used for other aquaporins, the recommended methodology for phylogenetic analysis of TIP4-3 includes:

  • Sequence collection: Gather TIP4-3 homologs from diverse plant species spanning major evolutionary lineages from algae to angiosperms.

  • Multiple sequence alignment: Align sequences using MUSCLE, MAFFT, or similar algorithms with manual curation of alignments.

  • Phylogenetic tree construction: Apply the Maximum Likelihood method (as used for TIP2;3 and PIP2;1 analyses ) using appropriate evolutionary models.

  • Conservation analysis: Identify conserved motifs across species using tools like MEME or WebLogo.

  • Divergence time estimation: Calculate substitution rates and estimate divergence times of TIP4-3 across different plant lineages.

This approach would reveal evolutionary patterns similar to those observed for TIP2;3, where distinct clades correspond to major plant lineages (Figure 5 in reference ).

How did the TIP4 subfamily expand during plant evolution?

The expansion of the TIP4 subfamily, including TIP4-3, appears to follow patterns observed for other TIPs. According to evolutionary analyses, major expansion of TIP subgroups likely originated in the ancestor of seed plants after divergence from ferns . This expansion coincides with the substantial proliferation of aquaporins during land plant evolution, reflecting their importance in water transport for terrestrial plant survival.

The number of species containing key aquaporin genes (including TIP subfamily members) increased by 2-3 times from Streptophyte algae to hornworts and maintained over 90% representation in seed plants . This pattern suggests that TIP4-3 and related aquaporins played crucial roles in the evolutionary adaptation of plants to terrestrial environments, where controlled water transport became essential for survival.

What expression systems are optimal for producing functional recombinant TIP4-3?

Based on available data and practices for other aquaporins, researchers have several options for TIP4-3 expression:

Expression SystemAdvantagesLimitationsApplications
E. coli- High yield
- Cost-effective
- Commercial availability with His-tag
- Potential improper folding
- Inclusion body formation
- Protein purification
- Antibody production
- Structural studies
Yeast (P. pastoris)- Eukaryotic processing
- High-density cultures
- Proper membrane insertion
- Longer production time
- More complex protocols
- Functional assays
- Transport studies
Xenopus oocytes- Native-like membrane environment
- Direct functional assays
- Lower yield
- Technical complexity
- Specialized equipment
- Water/solute transport assays
- Electrophysiology
Plant expression systems- Native post-translational modifications
- Native membrane environment
- Lower yield
- Longer production time
- In planta localization
- Physiological studies

E. coli expression is currently used for commercial production of His-tagged TIP4-3 and provides sufficient protein for many applications, though eukaryotic systems may be necessary for certain functional studies.

How can researchers effectively study TIP4-3's role in rice leaf development?

To investigate TIP4-3's role in rice leaf development, researchers should consider this methodological framework based on approaches used in rice developmental studies:

  • Expression analysis across developmental stages: Perform RT-PCR or RNA-Seq analysis of TIP4-3 expression across leaf primordia stages (P3, P4, P5) as identified in rice leaf development studies .

  • Spatial expression pattern: Use in situ hybridization to localize TIP4-3 mRNA in developing leaf tissue sections.

  • Protein localization: Generate antibodies against TIP4-3 or use epitope-tagged constructs for immunolocalization studies.

  • Functional analysis during leaf development: Create CRISPR knockout or RNAi lines to assess developmental phenotypes, particularly focusing on the P3/P4 transition identified as critical for photosynthetic development in rice .

  • Integration with developmental markers: Correlate TIP4-3 expression with established markers of vascular development and photosynthetic competence.

This approach would leverage the understanding that the P3/P4 transition represents a pivotal stage in rice leaf development where several processes for initiating photosynthetic competence are coordinated , potentially involving water transport processes mediated by aquaporins like TIP4-3.

What gene modification approaches are most effective for studying TIP4-3 function in planta?

For effective genetic modification of TIP4-3 in rice, researchers should consider:

  • CRISPR-Cas9 gene editing: Design guide RNAs targeting TIP4-3 coding sequences to create precise knockouts or specific mutations in functional domains.

  • Overexpression studies: Express TIP4-3 under constitutive (e.g., 35S, Ubiquitin) or tissue-specific promoters to assess gain-of-function phenotypes, similar to approaches used for PIP overexpression that enhanced salt tolerance in Arabidopsis .

  • Promoter-reporter fusions: Create TIP4-3 promoter:GUS or GFP fusions to study spatial and temporal expression patterns in transgenic plants.

  • Protein tagging: Generate C- or N-terminal fluorescent protein fusions for subcellular localization and trafficking studies, ensuring tags don't interfere with membrane insertion.

  • Inducible expression systems: Employ chemical or stress-inducible promoters to control TIP4-3 expression temporally for studying acute functional effects.

These approaches would provide complementary insights into TIP4-3 function in rice, particularly in relation to water transport, stress responses, and developmental processes.

How does TIP4-3 contribute to drought and salt stress responses in rice?

While specific information on TIP4-3's role in stress responses is not provided in the search results, functional analysis methodologies can be derived from studies of other aquaporins:

  • Expression analysis under stress conditions: Monitor TIP4-3 transcript and protein levels during drought, salt, and ABA treatments, similar to approaches used for OsPIP genes that revealed diverse expression responses to these stresses .

  • Physiological phenotyping: Compare water relations parameters (water potential, relative water content, hydraulic conductivity) between wild-type and TIP4-3-modified plants under stress conditions.

  • Cellular water flux measurements: Use cell pressure probe techniques or fluorescent dyes to assess changes in vacuolar water transport efficiency in plants with altered TIP4-3 expression.

  • Comparative analysis with other aquaporins: Determine if TIP4-3 shows expression patterns similar to other aquaporins that respond to stress, such as the OsPIP genes studied under salt, drought, and ABA treatments .

  • Transgenic approaches: Evaluate whether TIP4-3 overexpression confers enhanced stress tolerance similar to the improved salt tolerance observed in Arabidopsis plants overexpressing rice OsPIP1-1 or OsPIP2-2 .

This systematic approach would help establish TIP4-3's specific contributions to stress adaptation mechanisms in rice.

What experimental design best captures TIP4-3's role in cellular water homeostasis?

To effectively investigate TIP4-3's role in cellular water homeostasis, researchers should implement:

  • Subcellular localization confirmation: Use immunolocalization or fluorescent protein fusions to confirm TIP4-3's presence in the tonoplast and any potential redistribution under osmotic stress.

  • Vacuolar water transport assays: Isolate vacuoles from plants with normal, enhanced, or reduced TIP4-3 expression and measure water transport rates using stopped-flow techniques.

  • Tonoplast vesicle studies: Prepare tonoplast-enriched vesicles from plant tissues or heterologous expression systems and assess water permeability using light scattering methods.

  • Cell volume regulation analysis: Monitor cell volume adjustments in response to osmotic challenges in protoplasts from plants with modified TIP4-3 expression.

  • Interaction studies: Investigate potential interactions between TIP4-3 and other tonoplast proteins involved in ion transport or signaling through co-immunoprecipitation or split-ubiquitin yeast two-hybrid assays.

This comprehensive experimental design would provide mechanistic insights into TIP4-3's specific contributions to vacuolar water transport and cellular osmoregulation.

How does TIP4-3 function compare with other TIP subfamily members in rice?

A systematic comparison of TIP4-3 with other TIP subfamily members would require:

  • Substrate selectivity analysis: Compare water, small neutral solute, and hydrogen peroxide transport capabilities among different TIP isoforms using heterologous expression systems.

  • Expression pattern comparison: Contrast tissue-specific and developmental expression patterns of TIP4-3 with other TIP genes using RNA-Seq or qRT-PCR data.

  • Subcellular localization studies: Determine if TIP4-3 shows unique tonoplast subdomain localization or trafficking patterns compared to other TIPs.

  • Stress responsiveness: Compare transcriptional and post-translational regulation of TIP4-3 and other TIPs under various stress conditions.

  • Functional complementation: Assess whether TIP4-3 can functionally replace other TIP proteins in knockout mutants.

This comparative approach would help position TIP4-3 within the functional diversity of the TIP subfamily and reveal potential functional specialization.

What distinguishes the functional roles of TIP and PIP aquaporins in rice water relations?

The functional distinctions between TIP and PIP aquaporins involve:

  • Membrane localization: PIPs localize to the plasma membrane, controlling water entry/exit from the cell, while TIPs like TIP4-3 localize to the tonoplast, regulating water exchange between cytoplasm and vacuole .

  • Water permeability characteristics: Rice PIPs, particularly the PIP2 subgroup, typically show higher water channel activity than PIP1 members, which may have regulatory roles or transport other substrates . TIPs generally exhibit high water permeability but may show different substrate specificities from PIPs.

  • Expression regulation: Rice PIP genes show distinct expression responses to salt, drought, and ABA treatments , while TIP regulation patterns may differ, reflecting their distinct roles in cellular water homeostasis.

  • Evolutionary patterns: Both TIP and PIP subfamilies show high conservation across plant species, but with distinct evolutionary patterns that likely reflect their specialized functions .

  • Stress adaptation contributions: Overexpression studies show that rice PIPs (OsPIP1-1 and OsPIP2-2) can enhance salt tolerance when expressed in Arabidopsis , suggesting specific roles in stress adaptation that may differ from those of TIPs.

Understanding these distinctions is crucial for developing a comprehensive model of aquaporin-mediated water transport in rice under various developmental and environmental conditions.

What emerging technologies could advance our understanding of TIP4-3 function?

Cutting-edge approaches for TIP4-3 research include:

  • Cryo-electron microscopy: Determine high-resolution structures of TIP4-3 to understand its pore characteristics and gating mechanisms.

  • Single-molecule tracking: Visualize TIP4-3 dynamics in live cells using super-resolution microscopy with photoactivatable fluorescent proteins.

  • Nano-scale biophysical measurements: Apply atomic force microscopy to measure mechanical properties of membranes with different TIP4-3 content.

  • Systems biology integration: Incorporate TIP4-3 expression and function data into multi-omics models of rice water relations and stress responses.

  • CRISPR base editing and prime editing: Make precise amino acid substitutions in TIP4-3 without disrupting the entire gene to study structure-function relationships.

  • Synthetic biology approaches: Engineer novel properties into TIP4-3 to create plants with enhanced water use efficiency or stress tolerance.

These advanced approaches would provide unprecedented insights into TIP4-3 function at molecular, cellular, and whole-plant levels.

How can TIP4-3 research contribute to improving rice stress tolerance and water use efficiency?

Translational applications of TIP4-3 research include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.