Recombinant Oryza sativa subsp. japonica Probable isoprenylcysteine alpha-carbonyl methylesterase ICME (IMCE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag, please specify your requirements; we will prioritize development accordingly.
Synonyms
IMCE; Os05g0577200; LOC_Os05g50170; OJ1126_B10.7; Probable isoprenylcysteine alpha-carbonyl methylesterase ICME
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
IMCE
Target Protein Sequence
MQPASPVSGDAGPVAEAVPPRGAPQVLVRRRSVPFSPDSPLAPGSRGGGERRSTFREDVS HAAAETYLVTRLAFILLRYLGVGYRWISQLAALIIYAILLMPGFIRVGYYYFFSRQVLRS VIYGDQPRNRLDLYIPRDPKKPSPVVAFVTGGAWIIGYKAWGALLGRRLAERGIIVACID YRNFPQGTISDMVSDASDGISFVCETVGAYGGDPNQIYLMGQSAGAHIAACALLEQAAKE SRGEQISWSVTQIKAYFGLSGGYNIENLVDHFHERGLYRSIFLSIMEGKKSLPHFSPETV AKKLCPETIALLPQIVLLHGTDDYSIPFSASETFAGVLKQAGAKAKLLLYEGKTHTDVFL QDPLRGGRDKLVEDVISVIHADDADAREKDALAPIPGRLVSEWQIKLAHRISPF
Uniprot No.

Target Background

Function
This recombinant *Oryza sativa* subsp. *japonica* Probable isoprenylcysteine alpha-carbonyl methylesterase (ICME/IMCE) catalyzes the demethylation of isoprenylcysteine methylesters.
Database Links
Protein Families
AB hydrolase superfamily, Isoprenylcysteine methylesterase family
Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ICME in Oryza sativa subsp. japonica?

The probable isoprenylcysteine alpha-carbonyl methylesterase (ICME) in Oryza sativa subsp. japonica is hypothesized to play a role in post-translational modification of proteins through the cleavage of methyl esters from prenylated proteins. This enzymatic activity is critical for regulating protein localization and function, particularly within signaling pathways that involve prenylated proteins. Prenylation typically facilitates the attachment of proteins to cellular membranes, and demethylation by ICME may influence their interactions with other cellular components or their recycling within the cell.

Experimental studies have demonstrated that ICME enzymes are involved in the processing of prenylated proteins such as small GTPases, which are essential for intracellular signaling and membrane trafficking. In plants, these processes are crucial for stress responses, growth regulation, and development. Transcriptomic analyses have shown differential expression of ICME-related genes under various environmental conditions, suggesting its involvement in adaptive responses .

How is ICME activity measured experimentally?

The enzymatic activity of ICME can be measured using biochemical assays that detect the release of methyl groups from prenylated substrates. A common approach involves using synthetic peptides or proteins modified with isoprenylcysteine methyl esters as substrates. The reaction products can be quantified using chromatographic techniques such as high-performance liquid chromatography (HPLC) or mass spectrometry.

In addition to direct enzymatic assays, researchers often use genetic approaches to study ICME activity. For example, overexpression or knockdown of ICME genes in model organisms or cell lines can reveal phenotypic changes associated with altered enzyme activity. Furthermore, transcriptomic and proteomic analyses can provide insights into downstream effects and regulatory networks involving ICME .

What are the structural characteristics of ICME?

The structure of ICME includes conserved motifs characteristic of alpha/beta hydrolase fold enzymes, which are known for their catalytic versatility. Structural modeling studies suggest that the active site contains residues critical for binding prenylated substrates and catalyzing the cleavage of methyl esters.

Crystallographic studies on homologous enzymes have provided insights into the three-dimensional arrangement of active site residues and their interactions with substrates or inhibitors. Such structural information is invaluable for designing experiments to probe enzyme specificity and mechanism .

What experimental systems are used to study recombinant ICME?

Recombinant ICME is typically expressed in heterologous systems such as Escherichia coli or yeast (Saccharomyces cerevisiae) due to their ease of genetic manipulation and scalability for protein production. These systems allow researchers to produce large quantities of purified enzyme for biochemical characterization.

Plant-based expression systems, including transient expression in Nicotiana benthamiana, are also employed when post-translational modifications specific to plants are required for functional studies. These systems provide a more physiologically relevant context for studying plant-specific enzymes like ICME .

What role does ICME play in plant stress responses?

ICME is implicated in modulating stress responses by regulating signaling pathways mediated by prenylated proteins such as small GTPases and kinases. These proteins are involved in processes like oxidative stress management, hormone signaling, and pathogen defense.

Transcriptomic studies have revealed upregulation of ICME-related genes under abiotic stresses such as drought and salinity, as well as biotic stresses like pathogen infection. Functional studies using loss-of-function mutants or overexpression lines have further confirmed its role in enhancing stress tolerance through modulation of downstream signaling networks .

How can researchers design experiments to study the substrate specificity of ICME?

To investigate substrate specificity, researchers should employ a combination of biochemical assays and structural biology approaches:

  • Substrate Libraries: Generate libraries of synthetic peptides or proteins modified with different prenyl groups (e.g., farnesyl or geranylgeranyl) to test substrate preferences.

  • Mutagenesis Studies: Perform site-directed mutagenesis on key active site residues to identify determinants of substrate binding and catalysis.

  • Structural Analysis: Use X-ray crystallography or cryo-electron microscopy to visualize substrate-enzyme complexes at atomic resolution.

  • Kinetic Studies: Measure reaction rates with various substrates to determine kinetic parameters such as KmK_m (substrate affinity) and kcatk_{cat} (turnover number).

These approaches can be complemented by computational modeling to predict substrate binding modes and guide experimental design .

What challenges arise when interpreting transcriptomic data related to ICME expression?

Interpreting transcriptomic data requires careful consideration of several factors:

  • Tissue-Specific Expression: ICME expression may vary across tissues, necessitating spatially resolved transcriptomic analyses.

  • Environmental Context: Differential expression patterns under stress conditions must be correlated with physiological outcomes.

  • Post-Transcriptional Regulation: Transcript levels may not directly correlate with protein abundance or activity due to post-transcriptional modifications or degradation.

To address these challenges, researchers should integrate transcriptomic data with proteomics and metabolomics to obtain a holistic view of ICME function .

How can conflicting data on ICME function be reconciled?

Conflicting data often arise from differences in experimental conditions, such as variations in growth media, environmental factors, or genetic backgrounds of model organisms:

  • Standardization: Use standardized protocols and reagents across experiments.

  • Replication: Conduct experiments in multiple independent laboratories.

  • Meta-Analysis: Perform meta-analyses combining data from multiple studies to identify consistent trends.

Additionally, advanced statistical methods can help account for variability and identify sources of discrepancy .

What bioinformatics tools are available for analyzing ICME-related genes?

Several bioinformatics tools are useful for studying ICME-related genes:

  • Sequence Analysis: Tools like BLAST and Clustal Omega for sequence alignment and identification of conserved domains.

  • Structural Modeling: Software such as PyMOL or Chimera for visualizing protein structures.

  • Gene Expression Analysis: Platforms like RNA-Seq pipelines (e.g., HISAT2, StringTie) for analyzing transcriptomic data.

  • Pathway Analysis: KEGG or Reactome databases for mapping genes onto metabolic pathways.

These tools enable comprehensive analyses ranging from sequence-level insights to functional annotations .

How can researchers validate the role of ICME in terpenoid biosynthesis?

To validate the involvement of ICME in terpenoid biosynthesis:

  • Gene Knockout/Knockdown: Use CRISPR/Cas9 or RNA interference to disrupt ICME expression and assess changes in terpenoid levels.

  • Overexpression Studies: Overexpress ICME in model plants or cell lines and measure terpenoid accumulation using mass spectrometry.

  • Enzyme Assays: Test whether recombinant ICME directly catalyzes reactions involving terpenoid intermediates.

Combining these approaches provides robust evidence linking ICME to terpenoid biosynthesis pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.