Recombinant Oryza sativa subsp. japonica Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 (IMCEL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
IMCEL2; Os01g0642000; P0039G05.24; P0510C12.9; Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2; Isoprenylcysteine methylesterase-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
IMCEL2
Target Protein Sequence
MRPVSSAEEVGALLSRSDSSGRRRRSSPVQSASPRPAGCGCGGPRRQSSFRDDVGHAASE TYLVTRLTFSLLQYLGLGYRWMSQLLALTIYAILLMPGFLQVGYYYFFSSQVRRSIVYGE QPRNRLDLYIPKDINRPCPVVAFVTGGAWIIGYKAWGSLLGRRLAERGIIVACIDYRNFP QGTIGDMVSDASQGISYVCNNIASYGGDPNRIYLVGQSAGAHIAACALIEQAVKESSGQS ISWSVTQIKAYFGLSGGYNMHSLVDHFHERGLNRSIFFSIMEGEESLSRYSPEIVVKQSS SQTIALLPPIVLMHGTEDYSIPSSARFLLMPSADVHLR
Uniprot No.

Target Background

Function
Catalyzes the demethylation of isoprenylcysteine methylesters.
Database Links

STRING: 39947.LOC_Os01g45460.1

UniGene: Os.28909

Protein Families
AB hydrolase superfamily, Isoprenylcysteine methylesterase family
Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of ICMEL2 in plant systems?

ICMEL2 (Isoprenylcysteine alpha-carbonyl methylesterase 2) functions in the demethylation pathway of prenylated proteins in rice. Methodologically, characterizing its function requires substrate specificity assays using synthetic isoprenylcysteine derivatives with detection through high-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS). For comprehensive analysis, researchers should establish enzyme kinetic parameters (Km, Vmax) under standardized conditions, comparing activity with other characterized methylesterases. Complete functional characterization requires expression of the recombinant protein in systems that maintain appropriate post-translational modifications while providing sufficient yield for downstream applications.

What expression systems are optimal for recombinant ICMEL2 production?

Recombinant ICMEL2 can be produced using several expression systems, each with distinct advantages and considerations:

  • Homologous expression in Oryza sativa: Maintains native post-translational modifications but may present purification challenges.

  • Heterologous plant systems (Arabidopsis, Nicotiana): Provide plant-specific processing with potentially higher yield.

  • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae): Enable eukaryotic processing with scalability.

  • Bacterial systems (E. coli): Offer high yield but lack eukaryotic modifications.

Research on other recombinant proteins expressed in Oryza sativa has shown significant expression system-dependent modifications that affect protein structure and function. For instance, recombinant human serum albumin (rHSA) produced in rice (OsrHSA) exhibits extensive glycation of lysine and arginine residues not observed in yeast-expressed variants . Researchers should comprehensively characterize ICMEL2 from different expression systems using multiple analytical techniques to identify the optimal system for their specific research objectives.

What analytical techniques should be employed for initial characterization of recombinant ICMEL2?

Initial characterization of recombinant ICMEL2 requires a multi-technique approach:

Analytical TechniquePurposeKey Parameters
Size Exclusion Chromatography (SEC)Assess aggregation state% Monomeric content, High-molecular-weight species
Reversed-Phase HPLC (RP-HPLC)Determine purity, detect modificationsRetention time, Peak symmetry, Peak area
Capillary Electrophoresis (CE)Analyze charge variantsMigration pattern, Isoelectric profile
LC-MSIdentify post-translational modificationsMass accuracy, Sequence coverage, Modified residues
Circular Dichroism (CD)Evaluate secondary structureα-helix, β-sheet content
Fluorescence SpectroscopyAssess tertiary structureλmax emission, Intensity

Studies of recombinant proteins from Oryza sativa have demonstrated that LC-MS is particularly important for identifying hexose-glycated residues that can affect protein structure and function . Methodologically, researchers should establish a systematic characterization workflow beginning with purity assessment followed by detailed structural analysis and functional testing.

How do post-translational modifications affect the structural integrity and function of recombinant ICMEL2?

Post-translational modifications (PTMs) of recombinant proteins expressed in Oryza sativa can significantly impact their structural integrity and function. Research on OsrHSA has demonstrated that extensive glycation of lysine and arginine residues correlates with alterations in tertiary structure and the formation of non-monomeric species . For ICMEL2, a systematic approach to investigating PTM impact should include:

  • Comprehensive mapping of modifications using LC-MS/MS with sequence coverage >80%.

  • Correlation analysis between modification patterns and functional parameters.

  • Comparative structural analysis using spectroscopic methods (CD, fluorescence).

  • Molecular dynamics simulations to predict structural perturbations caused by specific modifications.

Studies have shown that the degree of glycation in OsrHSA positively correlates with the quantity of non-monomeric species and alters chromatographic profiles . Similar mechanisms may affect ICMEL2, potentially impacting its enzymatic activity through modification of catalytically important residues or alterations in substrate binding pockets.

What strategies can minimize lot-to-lot variability in recombinant ICMEL2 production?

Minimizing lot-to-lot variability in recombinant ICMEL2 production requires robust control strategies throughout the production process:

  • Growth condition standardization:

    • Control light/dark cycles rigorously (glycation mechanisms in plants may involve light cycles)

    • Standardize nutrient composition and harvest timing

    • Maintain consistent temperature and humidity profiles

  • Purification protocol optimization:

    • Implement validated purification methods with defined acceptance criteria

    • Utilize automated systems to reduce operator variability

    • Apply in-process controls at critical steps

  • Comprehensive characterization:

    • Employ multiple orthogonal analytical methods

    • Establish acceptance criteria for critical quality attributes

    • Implement statistical process control for trend monitoring

Research on OsrHSA revealed significant lot-to-lot variability in glycation patterns from the same supplier, with varying degrees of modification at specific lysine and arginine residues . Similar variability might affect ICMEL2, necessitating rigorous characterization of each production lot.

How should researchers design experiments to assess ICMEL2 enzymatic activity?

Designing robust experiments to assess ICMEL2 enzymatic activity requires careful consideration of multiple factors:

  • Substrate selection and preparation:

    • Use purified synthetic isoprenylcysteine derivatives as substrates

    • Prepare substrate concentrations spanning at least one order of magnitude around the expected Km

    • Include structurally similar non-substrate controls

  • Reaction condition optimization:

    • Systematically evaluate pH optima (typically pH 5.0-9.0)

    • Determine temperature optima (typically 25-40°C)

    • Assess buffer composition effects

    • Evaluate potential cofactor requirements

  • Experimental controls:

    • Include heat-inactivated enzyme as negative control

    • Run substrate-only controls to account for spontaneous hydrolysis

    • Use known methylesterases as positive controls when possible

When conducting enzymatic assays, researchers should follow established experimental design principles, ensuring that all potential confounding variables are controlled . This includes standardizing enzyme concentration, substrate purity, and incubation conditions to ensure reproducibility.

What controls are essential in experiments involving recombinant ICMEL2?

Essential controls for experiments involving recombinant ICMEL2 include:

Control TypePurposeImplementation
Expression system controlsAccount for system-specific effectsEmpty vector preparation, Related methylesterase from same system
Activity assay controlsDistinguish enzymatic from non-enzymatic effectsSubstrate stability control, Denatured enzyme control
Structural analysis controlsEnsure assay validityReference protein control, Buffer-only baseline
Specificity controlsVerify enzyme specificitySubstrate analogs, Competitive inhibitors

When designing these controls, researchers should adhere to the principle that confounding variables must be accounted for to ensure research validity . For instance, when studying mutations in ICMEL2, the wild-type protein produced and purified under identical conditions serves as the appropriate control rather than a commercial preparation.

How can researchers account for confounding variables in ICMEL2 expression and purification?

Accounting for confounding variables in ICMEL2 expression and purification requires systematic experimental design:

  • Variable identification:

    • Expression-related variables: Growth conditions, harvest time, expression level

    • Purification-related variables: Buffer composition, column conditions, protein concentration

  • Control strategies:

    • Factorial experimental design to identify significant variables

    • Process parameter monitoring and documentation

    • Sample randomization during analysis

  • Statistical approaches:

    • Analysis of variance (ANOVA) to identify significant factors

    • Response surface methodology for process optimization

    • Statistical process control for monitoring

Research on recombinant proteins has demonstrated that variables such as light/dark cycles during plant growth can affect protein glycation . Similarly, growth conditions of Oryza sativa, including glucose levels in the endosperm (up to 19 mg per g total weight), may affect modification patterns of recombinant proteins . Researchers should implement appropriate controls and documentation to account for these variables.

How should researchers interpret discrepancies in ICMEL2 activity across different expression systems?

Interpreting discrepancies in ICMEL2 activity across different expression systems requires a systematic investigation of multiple factors:

  • Post-translational modification analysis:

    • Conduct comprehensive LC-MS analysis to identify differences in modifications

    • Map modifications to the protein structure to assess potential impact on active site

    • Correlate modification patterns with activity measurements

  • Structural comparison:

    • Compare secondary structure using far UV circular dichroism

    • Assess tertiary structure using fluorescence spectroscopy

    • Evaluate thermal stability profiles

Research on recombinant human serum albumin has demonstrated that expression system-dependent chemical modifications can lead to variability in structure, stability, and function . For instance, OsrHSA showed extensive glycation compared to yeast-expressed variants, resulting in altered tertiary structure and binding properties . A similar methodological approach could identify the mechanisms underlying any observed discrepancies in ICMEL2 activity.

What statistical approaches are most appropriate for analyzing ICMEL2 kinetic data?

Appropriate statistical approaches for analyzing ICMEL2 kinetic data include:

  • Enzyme kinetics modeling:

    • Non-linear regression analysis for Michaelis-Menten kinetics

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations as complementary approaches

    • Global fitting methods for complex kinetic mechanisms

  • Comparison between conditions:

    • Analysis of variance (ANOVA) for comparing multiple conditions

    • Student's t-test for pairwise comparisons (with appropriate corrections for multiple testing)

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) if normality assumptions are violated

For robust statistical analysis, researchers should follow the principles of experimental design that emphasize reliability (measurement stability and constancy) and validity (effectiveness of the measures) . This includes ensuring sufficient replication, randomization of experimental units, and appropriate controls to account for confounding variables.

What quality control metrics should be established for recombinant ICMEL2 production?

Establishing comprehensive quality control metrics for recombinant ICMEL2 production is essential for ensuring consistency and reliability. Based on approaches used for other recombinant proteins, the following metrics should be implemented:

Quality Control ParameterMethodTypical Acceptance Criteria
PuritySEC≥95% monomeric content
RP-HPLC≥95% main peak
SDS-PAGESingle major band at expected MW
IdentityLC-MSCorrect molecular mass (±0.5 Da)
Peptide mapping≥80% sequence coverage
Activity assaySpecific activity within reference range
StructureFar UV CDSpectral similarity to reference (≥90% match)
FluorescenceEmission maximum within reference range
ModificationsLC-MS/MSConsistent glycation pattern
StabilityAccelerated conditions≤15% activity loss after 2 weeks at 25°C
Freeze-thaw≤10% activity loss after 3 cycles

Research on OsrHSA has demonstrated the importance of comprehensive characterization for detecting lot-to-lot variability . Similar approaches should be implemented for ICMEL2, with acceptance criteria established based on initial characterization of reference standard material.

How can researchers assess batch-to-batch consistency of ICMEL2 preparations?

Assessing batch-to-batch consistency of ICMEL2 preparations requires a multi-parameter approach:

  • Reference standard strategy:

    • Establish a well-characterized reference batch

    • Compare each new batch using multiple analytical methods

    • Maintain long-term stability data on the reference standard

  • Comprehensive testing panel:

    • Physical characterization: SEC, RP-HPLC, CE profiles

    • Structural assessment: Far UV CD, fluorescence spectroscopy

    • Activity measurement: Substrate conversion kinetics

    • Modification analysis: LC-MS glycation mapping

Research on OsrHSA has demonstrated significant lot-to-lot variability in glycation patterns, which correlated with altered protein properties . For ICMEL2, similar attention to modification patterns would be crucial, with particular focus on modifications that might affect the active site or substrate binding regions.

What storage conditions optimize ICMEL2 stability and prevent activity loss?

Optimizing storage conditions for ICMEL2 stability requires systematic evaluation of multiple parameters:

Storage ParameterVariables to TestAnalysis Method
Buffer compositionpH (6.0-8.0), Buffer type, Ionic strength, AdditivesActivity retention over time
Temperature-80°C, -20°C, 4°C, Room temperatureStability at defined intervals
Freeze-thaw impactMultiple cycles, Freezing rate, CryoprotectantsActivity after each cycle
ConcentrationDilute vs. concentrated preparationsAggregation analysis by SEC
Container materialGlass vs. plastic, Surface treatmentsProtein recovery analysis

Research on recombinant proteins has shown that storage stability can be significantly affected by post-translational modifications. For instance, glycation of recombinant proteins can affect thermal stability . For ICMEL2, a systematically designed stability study should measure activity retention under various storage conditions over time.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.