Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 4 (APX4)

Shipped with Ice Packs

In Stock

Cat. No.

BT2500253

Source

in vitro E.coli expression system

Synonyms

APX4; Os08g0549100; LOC_Os08g43560; OJ1479_B11.9; Probable L-ascorbate peroxidase 4, peroxisomal; OsAPx4

Quick Inquiry

Description

Introduction to Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 4 (APX4)

Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 4 (APX4) is a genetically engineered enzyme derived from the rice subspecies Oryza sativa subsp. japonica. This enzyme is part of the ascorbate peroxidase family, which plays a crucial role in protecting plants from oxidative stress by detoxifying hydrogen peroxide (H $_2$ O $_2$ ), a reactive oxygen species (ROS) produced during normal metabolic processes and under stress conditions .

Function and Localization of APX4

APX4 is localized in the peroxisomes of rice cells, where it helps in the scavenging of H $_2$ O $_2$ generated during photorespiration and fatty acid beta-oxidation . The enzyme catalyzes the reduction of H $_2$ O $_2$ to water using ascorbate as an electron donor, thereby maintaining cellular redox balance and preventing oxidative damage .

Research Findings on APX4

Research on APX4 has shown that its silencing or knockdown in rice can lead to increased tolerance to oxidative stress under certain conditions. For instance, OsAPX4-RNAi plants exhibited enhanced photosynthetic activities and increased levels of proteins involved in the ascorbate-glutathione cycle when catalase (CAT) was inhibited . This suggests that APX4 plays a role in modulating antioxidant pathways in response to stress.

Condition	Effect on APX4 Activity	Plant Response
CAT Inhibition	Reduced APX4 Function	Enhanced Photosynthesis, Increased Antioxidant Proteins
Oxidative Stress	Increased H $_2$ O $_2$ Levels	Activation of Alternative Antioxidant Pathways

Role in Stress Tolerance

APX4 contributes to stress tolerance by regulating the levels of ROS in plant cells. Under conditions of high photorespiration, APX4-silenced plants show better acclimation to oxidative stress, indicating a compensatory mechanism involving other antioxidant enzymes .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time

Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.

Shelf Life

Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms

APX4; Os08g0549100; LOC_Os08g43560; OJ1479_B11.9; Probable L-ascorbate peroxidase 4, peroxisomal; OsAPx4

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-291

Protein Length

full length protein

Species

Oryza sativa subsp. japonica (Rice)

Target Names

APX4

Target Protein Sequence

MAAPVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRY EEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDS SVCPREGRLPDAKKGALHLRDIFYRMGLSDKDIVALSGGHTLGRAHPERSGFEGAWTQEP LKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLS ELGFTPRSSGPASTKSDLSTGAVLAQSAVGVAVAAAVVIVSYLYEASKKSK

Uniprot No.

Q6ZJJ1

Target Background

Function

Plays a crucial role in hydrogen peroxide detoxification.

Database Links

KEGG: osa:4346247

STRING: 39947.LOC_Os08g43560.1

UniGene: Os.10609

Protein Families

Peroxidase family, Ascorbate peroxidase subfamily

Subcellular Location

Peroxisome membrane; Single-pass membrane protein.

Tissue Specificity

Expressed in leaves, stems and flowers.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 4 (APX4)

Description

Introduction to Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 4 (APX4)

Function and Localization of APX4

Research Findings on APX4

Role in Stress Tolerance

Product Specs

Target Background

Quick Inquiry

Category

Service