Recombinant Oryza sativa subsp. japonica Probable L-ascorbate peroxidase 8, chloroplastic (APX8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations are stable for 6 months at -20°C/-80°C, while lyophilized forms remain stable for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
APX8; Os02g0553200; LOC_Os02g34810; P0470G10.5; Probable L-ascorbate peroxidase 8, chloroplastic; OsAPx8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
77-478
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
APX8
Target Protein Sequence
CMAAAAVAASDAAQLKSAREDIREILKTTYCHPIMVRLGWHDSGTYDKNIEEWPQRGGAD GSLRFDAELSHGANAGLINALKLIQPIKDKYPGITYADLFQLASATAIEEAGGPKIPMKY GRVDVTAAEQCPPEGRLPDAGPRVPADHLREVFYRMGLDDKEIVALSGAHTLGRSRPDRS GWGKPETKYTKDGPGEPGGQSWTVEWLKFDNSYFKDIKEQRDQDLLVLPTDAALFEDPSF KVYAEKYAEDQEAFFKDYAEAHAKLSDLGAKFDPPEGFSLDDEPAVEEKDPEPAPAPAAA PPPPPVEEKKEAEPTPVPVTVGAAVASSPADDNNGAAPQPEPFVAAKYSYGKKELSDSMK QKIRAEYEGFGGSPDKPLQSNYFLNIMLLIGGLAFLTSLLGS
Uniprot No.

Target Background

Function
This protein is involved in defense responses and tolerance to the bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo). It plays a crucial role in hydrogen peroxide removal during Xoo infection and contributes to abiotic stress response, particularly in mitigating oxidative damage during salt stress.
Gene References Into Functions
  1. Overexpression studies demonstrated increased tolerance to bacterial blight, while RNA interference (RNAi) lines showed significantly enhanced sensitivity compared to controls. PMID: 27185545
Database Links
Protein Families
Peroxidase family, Ascorbate peroxidase subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves, stems and flowers. Expressed in leaves, shoots and panicles. Expressed at low levels in roots.

Q&A

What is the fundamental role of APX8 in rice plants?

APX8 is a chloroplastic isoform of ascorbate peroxidase that functions primarily as an H₂O₂-scavenging enzyme in the thylakoid membranes of chloroplasts. It utilizes ascorbate as a specific electron donor to convert hydrogen peroxide to water, thereby protecting chloroplast components from oxidative damage. The enzyme belongs to a family of eight APX isoforms in rice (Oryza sativa), with distinct subcellular localizations: cytosolic (OsAPx1 and OsAPx2), peroxisomal (OsAPx3 and OsAPx4), mitochondrial (OsAPx5 and OsAPx6), chloroplast stroma (OsAPx7), and chloroplast thylakoid (OsAPx8) . This spatial organization suggests a specialized role for APX8 in protecting photosynthetic machinery from ROS accumulation during environmental stress conditions.

How is APX8 expression regulated under salt stress conditions?

Salt stress significantly impacts APX8 expression in a concentration-dependent manner. Research demonstrates that NaCl treatments at 150 mM, 200 mM, and 300 mM all lead to increased expression of OsAPx8 in rice roots, while having minimal effects on most other APX isoforms. This selective upregulation implies that APX8 plays a specialized role in salt stress response mechanisms . The regulation pathway involves abscisic acid (ABA) as a key mediator, as evidenced by experiments using fluridone (an inhibitor of carotenoid biosynthesis that blocks ABA production). When fluridone treatment suppressed ABA accumulation, the salt-induced expression of OsAPx8 was also inhibited, indicating that ABA is required for salt-mediated APX8 expression .

Which specific components of salt stress trigger APX8 expression?

Detailed experiments have established that Na⁺ ions, rather than Cl⁻ ions, are the primary triggers for enhanced OsAPx8 expression during salt stress. This was demonstrated through comparative studies examining the effects of various salt treatments. The specific Na⁺-dependent induction of APX8 suggests a specialized role in sodium stress resistance mechanisms. Interestingly, while H₂O₂ treatment could enhance OsAPx8 induction, it did not lead to ABA accumulation, suggesting that hydrogen peroxide operates through a parallel pathway that converges on APX8 expression .

What is the relationship between drought stress and APX8 expression patterns?

Research indicates that drought stress affects APX8 expression differently than salt stress. While salt stress increases APX8 expression, studies suggest that OsAPx8 is repressed during drought stress conditions. This repression is part of a mechanism related to increased ROS levels and stomatal closure . The differential regulation under different stress conditions highlights the specialized functions of APX8 in the complex network of stress responses. The contrasting expression patterns between drought and salt stress warrant further investigation to understand the regulatory mechanisms that determine stress-specific responses.

What are the most effective methods for studying APX8 gene expression?

For comprehensive analysis of APX8 expression, researchers should employ a multi-method approach:

  • Semi-quantitative RT-PCR: This method has been successfully used to quantify mRNA levels of APX8 and other APX isoforms in rice roots under various stress conditions . Primer design should ensure specificity for APX8 to avoid cross-amplification of other APX isoforms.

  • Quantitative Real-Time PCR (qRT-PCR): This provides more precise quantification of expression levels and is ideal for detecting subtle changes in expression patterns across different tissues and stress conditions.

  • RNA-Seq Analysis: This approach offers a comprehensive view of transcriptome-wide changes, allowing researchers to understand APX8 regulation in the context of global gene expression patterns.

  • Promoter Analysis: Cloning and characterizing the APX8 promoter region can help identify cis-regulatory elements involved in stress-responsive expression. This can be coupled with reporter gene assays to visualize expression patterns in vivo.

Each method should be complemented with appropriate controls, including reference genes with stable expression under the experimental conditions being studied.

What strategies can be used to create recombinant APX8 for functional studies?

Production of recombinant APX8 for functional characterization involves several critical steps:

  • Gene Cloning and Vector Construction: The APX8 CDS should be amplified from rice leaf cDNA using specific primers. For subcellular localization studies, consider creating translational fusions with fluorescent proteins as demonstrated for OsAPX7, where YFP and HA tags were used . The expression construct should be placed under a suitable promoter (e.g., CaMV 35S promoter).

  • Expression Systems:

    • Bacterial expression: E. coli systems can be used for producing recombinant protein for enzymatic assays.

    • Plant transformation: Rice protoplast transformation can be used for transient expression studies, particularly for localization and interaction studies.

    • Stable transformation: Agrobacterium-mediated transformation for generating stable transgenic rice lines for long-term functional studies.

  • Protein Purification: Affinity chromatography using tag-based systems (His-tag, GST-tag) allows for efficient purification of recombinant APX8.

  • Activity Assays: Spectrophotometric methods can be used to measure APX activity by monitoring the decrease in absorbance at 290 nm as ascorbate is oxidized.

How should researchers interpret contradictory APX8 expression data across different stress conditions?

When facing contradictory data regarding APX8 expression, researchers should consider several factors:

  • Stress Specificity: APX8 shows opposite responses to salt stress (upregulation) versus drought stress (downregulation) . This is not contradictory but reflects the complex role of APX8 in different stress response networks.

  • Concentration Effects: The degree of APX8 induction varies with NaCl concentration (150mM, 200mM, 300mM), indicating a dose-dependent response . Experimental designs should include concentration gradients rather than single-point measurements.

  • Tissue Specificity: Expression patterns may differ between roots, shoots, and other tissues. Most available data focuses on root expression, but chloroplastic APX8 likely has important functions in photosynthetic tissues.

  • Temporal Dynamics: Expression changes should be monitored over time, as early and late responses to stress may differ significantly.

  • Subspecies Variation: Consider genetic background effects, as indica and japonica subspecies may exhibit different expression patterns due to underlying genetic differences in stress response mechanisms .

Stress TypeAPX8 ExpressionMediating FactorsPhysiological Significance
Salt Stress (150-300mM NaCl)UpregulatedABA, Na⁺ ionsEnhanced H₂O₂ scavenging capacity
Drought StressDownregulatedIncreased ROS, Stomatal closurePossibly involved in stress signaling
H₂O₂ TreatmentEnhanced inductionIndependent of ABADirect oxidative stress response

What statistical approaches are recommended for analyzing APX8 expression data?

For robust statistical analysis of APX8 expression data:

  • Multiple Biological Replicates: Use at least three independent biological replicates to account for natural variation.

  • Appropriate Statistical Tests:

    • For comparing expression across multiple conditions: ANOVA followed by post-hoc tests (e.g., Tukey's HSD)

    • For comparing two conditions: Student's t-test or non-parametric alternatives if normality assumptions are violated

    • For expression time-course data: Repeated measures ANOVA or mixed-effects models

  • Correlation Analyses: Examine correlations between APX8 expression and physiological parameters (e.g., H₂O₂ levels, Na⁺ content, photosynthetic efficiency) to understand functional relationships.

  • Multivariate Analyses: Principal component analysis (PCA) or hierarchical clustering can help identify patterns when analyzing multiple APX isoforms across different conditions.

  • Normalization Strategies: For qRT-PCR data, use multiple reference genes validated for stability under the experimental conditions rather than relying on a single housekeeping gene.

What are the key unresolved questions regarding APX8 function in rice?

Several critical questions remain regarding APX8 function:

  • Subspecies Differences: How do genetic variations between indica and japonica subspecies affect APX8 expression and function, particularly in light of their different Na⁺ accumulation patterns ?

  • Regulatory Networks: What transcription factors directly control APX8 expression in response to stress signals, and how do they interact with ABA signaling pathways?

  • Post-translational Modifications: How is APX8 activity regulated at the protein level during stress responses?

  • Thylakoid Membrane Integration: What protein-protein interactions facilitate APX8 integration into thylakoid membranes, and how does this affect photosystem protection?

  • Evolutionary Conservation: How conserved is APX8 function across different rice varieties and related cereal crops?

Addressing these questions will require integrative approaches combining molecular genetics, biochemistry, and systems biology.

How might APX8 research contribute to developing stress-tolerant rice varieties?

APX8 research has significant potential for rice improvement strategies:

  • Marker-Assisted Selection: Identification of favorable APX8 alleles or expression patterns could provide molecular markers for selecting salt-tolerant varieties.

  • Genetic Engineering Approaches: Modulating APX8 expression might enhance salt tolerance, although the complex relationship with drought stress requires careful consideration to avoid unintended consequences.

  • Pathway Engineering: Rather than modifying APX8 alone, engineering the entire ROS scavenging system or ABA signaling pathway might provide more robust stress tolerance.

  • Precision Breeding: Understanding subspecies differences in APX8 regulation could inform crossing strategies between indica and japonica varieties to combine beneficial traits .

  • Stress-Specific Promoters: The APX8 promoter could be characterized and used to drive stress-responsive expression of other beneficial genes.

The specialized role of APX8 in salt stress response and its interaction with ABA signaling pathways position it as a valuable target for research aimed at improving rice performance under adverse environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.