Recombinant Oryza sativa subsp. japonica Probable mannan synthase 11 (CSLA11)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization

CSLA11 is a recombinant protein expressed in E. coli and purified to >90% purity (SDS-PAGE validation) . Key features include:

ParameterDetail
UniProt IDQ6YWK8
Gene NameCSLA11, LOC_Os08g33740, Os08g0434500
Protein LengthFull-length (1–570 amino acids)
HostE. coli
TagN-terminal His-tag
StorageLyophilized powder, stored at -20°C/-80°C
BufferTris/PBS-based with 6% trehalose, pH 8.0

The protein’s sequence includes conserved motifs for glycosyltransferase activity, such as the D, D, D, QXXRW motif, critical for nucleotide sugar binding .

Functional Roles in Polysaccharide Biosynthesis

CSLA11 is hypothesized to catalyze the polymerization of β-1,4-mannan backbones using GDP-mannose as a substrate . Key functional insights include:

Substrate Specificity

  • Primary Activity: β-mannan synthesis via GDP-mannose incorporation .

  • Dual Functionality: Potential to synthesize β-glucans or glucomannans if GDP-glucose is available .

  • Enzymatic Flexibility: Homologs (e.g., Arabidopsis CSLA9) produce mannan, glucan, or glucomannan polymers depending on substrate availability .

CSLA11 is heterologously expressed in E. coli using standard prokaryotic systems. Key steps include:

StepDetail
Expression HostE. coli BL21(DE3)
PurificationNi-NTA affinity chromatography (His-tag)
ReconstitutionDeionized water (0.1–1.0 mg/mL), with glycerol (5–50% final)

Challenges in functional validation, as seen in related studies (e.g., Coffea canephora CcMANS1), highlight the need for optimized activity assays .

Homologous Studies

  • Arabidopsis CSLA9: Demonstrated β-mannan, β-glucan, and glucomannan synthesis in vitro .

  • CSLA vs. CSLD: CSLA proteins (e.g., CSLA11) favor glucomannan production, while CSLDs synthesize pure mannans .

  • Mutant Analysis: csla mutants in Arabidopsis show reduced glucomannan content, validating CSLA’s role .

Evolutionary Conservation

CSLA11 homologs are present in diverse plants (e.g., Arabidopsis, Coffea), suggesting conserved roles in cell wall biosynthesis .

Potential Uses

  • Biotechnology: Engineering mannans for biofuels or bioplastics .

  • Agriculture: Modulating cell wall composition in rice for improved disease resistance or yield .

Research Gaps

  • Direct Activity Validation: No published enzymatic assays confirm CSLA11’s activity .

  • Substrate Preference: Clarifying whether CSLA11 prioritizes mannose or glucose in rice tissues .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Kindly consult your local distributors for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
CSLA11; Os08g0434500; LOC_Os08g33740; P0413H11.13; P0431A03.35; Probable glucomannan 4-beta-mannosyltransferase 11; Cellulose synthase-like protein A11; OsCslA11; Glucomannan synthase; Mannan synthase 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-570
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA11
Target Protein Sequence
MSSSGGGGVAEEVARLWGELPVRVVWAAVAAQWAAAAAAARAAVVVPAVRALVAVSLAMT VMILAEKLFVAAVCLAVRAFRLRPDRRYKWLPIGAAAAAASSEDDEESGLVAAAAAFPMV LVQIPMFNEREVYKLSIGAACSLDWPSDRVVIQVLDDSTDLVVKDLVEKECQKWQGKGVN IKYEVRGNRKGYKAGALKEGLKHDYVKECEYIAMFDADFQPESDFLLRTVPFLVHNSEIA LVQTRWKFVNANECLLTRFQEMSLDYHFKYEQEAGSSVYSFFGFNGTAGVWRIAAIDDAG GWKDRTTVEDMDLAVRATLQGWKFVYVGDVKVKSELPSTFKAYRFQQHRWSCGPANLFKK MMVEILENKKVSFWNKIHLWYDFFFVGKIAAHTVTFIYYCFVIPVSVWLPEIEIPLWGVV YVPTVITLCKAVGTPSSFHLVILWVLFENVMSLHRIKAAVTGILEAGRVNEWVVTEKLGD ANKTKPDTNGSDAVKVIDVELTTPLIPKLKKRRTRFWDKYHYSEIFVGICIILSGFYDVL YAKKGYYIFLFIQGLAFLIVGFDYIGVCPP
Uniprot No.

Target Background

Function
This protein is a probable mannan synthase, exhibiting 4-beta-mannosyltransferase activity on mannan using GDP-mannose as a substrate. The beta-1,4-mannan product serves as the backbone for galactomannan synthesis catalyzed by galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide found in plant cell walls.
Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA11 and what is its biological function in rice plants?

CSLA11 (Cellulose Synthase-Like A11) is a member of the CSLA gene family in Oryza sativa subsp. japonica that encodes a Golgi-localized β-glycan synthase. Similar to other CSLA proteins, it likely functions as a mannan synthase that polymerizes the β-linked mannan backbone of hemicellulosic polysaccharides in plant cell walls . The enzyme specifically catalyzes the formation of β-1,4-linked mannan polymers using GDP-mannose as a substrate, and can potentially produce glucomannans when supplied with both GDP-mannose and GDP-glucose . These hemicelluloses are critical structural components of cell walls that contribute to plant growth, development, and stress resistance. In rice, CSLA11 is identified as a "probable mannan synthase" based on sequence homology with characterized CSLA family members .

What are the optimal storage and handling conditions for recombinant CSLA11?

For long-term storage of recombinant CSLA11, the following conditions are recommended:

  • Store lyophilized powder at -20°C or -80°C upon receipt.

  • After reconstitution, add glycerol to a final concentration of 5-50% (with 50% being optimal for most applications).

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles, which can compromise protein activity.

  • For working stocks, store aliquots at 4°C for up to one week .

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Gently mix until completely dissolved .

Maintaining protein stability is critical for enzymatic assays, as repeated freeze-thaw cycles can significantly reduce the activity of glycosyltransferases like CSLA11.

What are the optimal reaction conditions for assessing CSLA11 enzymatic activity?

Based on studies with related β-mannan synthases, the following reaction conditions are recommended for optimal CSLA11 activity:

Temperature and pH optimization:

  • Temperature range: 30-80°C with optimal activity typically observed at 60°C

  • pH range: 4.0-9.0 with optimal activity typically at pH 6.0

Reaction buffer components:

  • 20 mM MES buffer, pH 6.0

  • Enzyme concentration: 1.0 μg mL⁻¹ of purified protein

  • Substrate concentration: 10 mM GDP-mannose and/or GDP-glucose

  • Optional addition of acceptor molecules (mannose or β-1,4-mannosides)

  • Reaction volume: typically 10 mL for product characterization

Incubation time:

  • For initial activity testing: 1-4 hours

  • For product accumulation and characterization: 24 hours

For measurement of mannan synthesis by reverse phosphorolysis, the reaction yield can be calculated using the formula:

P=[Mi]final[αMan1P]initial×[D-Mannose]initialP = \frac{[\text{Mi}]_{\text{final}}}{[\alpha\text{Man1P}]_{\text{initial}} \times [\text{D-Mannose}]_{\text{initial}}}

Where [Mi]final is the final molar concentration of β-1,4-D-mannosides with a DP ranging from 2 to 6, [αMan1P]initial is the initial molar concentration of αMan1P, and [D-Mannose]initial is the initial molar concentration of D-mannose .

How can the products of CSLA11 enzymatic activity be analyzed and characterized?

Several complementary techniques can be employed to characterize the mannan products synthesized by CSLA11:

High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection (HPAEC-PAD):

  • Primary method for determining the degree of polymerization (DP) of synthesized mannans

  • Can identify mannan oligomers ranging from DP 1 to DP 16

  • Samples may require solubilization in NaOH prior to analysis for insoluble high-DP products

Transmission Electron Microscopy (TEM):

  • For visualization of mannan crystal morphology

  • Sample preparation: Wash precipitated mannans 3 times with 20 mM MES buffer (pH 6.0) to remove enzyme

  • Resuspend in the same buffer for TEM analysis

X-ray Diffraction (XRD):

  • For structural characterization of crystalline mannan products

  • Provides information on the allomorphic form (e.g., mannan I)

Size-Exclusion Chromatography:

  • For determination of molecular weight distribution of soluble mannan products

Table 1: Expected Mannan Product Distribution from CSLA11 Activity

FractionMannan Chain Length (DP)Solubility Characteristics
Soluble1-11Fully soluble in aqueous buffer
Partially Soluble7-11Partially precipitates during reaction
Insoluble12-16Forms crystals, requires NaOH for solubilization

The analysis should include fractionation of the reaction products by centrifugation at 10,000g for 10 minutes to separate the soluble and precipitated fractions for individual characterization .

How can heterologous expression systems be optimized for functional CSLA11 production?

While E. coli is commonly used for CSLA11 expression, insect cell expression systems like Drosophila Schneider 2 (S2) cells can provide significant advantages for functional studies of plant glycosyltransferases. The following protocol is recommended based on successful expression of other CSLA family members:

  • Vector Selection and Construction:

    • Use vectors with strong promoters suitable for insect cells (e.g., metallothionein promoter)

    • Include appropriate secretion signals if secreted protein is desired

    • Incorporate epitope tags (His, FLAG, etc.) for detection and purification

  • Transfection and Stable Cell Line Generation:

    • Transfect S2 cells using calcium phosphate or lipid-based transfection reagents

    • Select stable transformants using appropriate antibiotic resistance

    • Confirm integration and expression by Western blot or RT-PCR

  • Induction and Expression:

    • Induce expression with copper sulfate (typically 0.5-1 mM)

    • Optimize expression time (typically 48-72 hours post-induction)

    • Harvest cells or culture medium depending on construct design

  • Protein Extraction and Purification:

    • For membrane-bound proteins, use detergent solubilization (e.g., 1% Triton X-100)

    • Purify using affinity chromatography based on incorporated tags

    • Verify protein integrity by SDS-PAGE and Western blot

This approach allows for proper post-translational modifications and Golgi localization that may be critical for CSLA11 function, as demonstrated for other CSLA proteins that were successfully expressed and functionally characterized in insect cells .

How does CSLA11 compare to other members of the CSLA family in terms of substrate specificity?

CSLA11 belongs to the CSLA gene family in rice, which is orthologous to the CSLA family in Arabidopsis. Based on functional studies of CSLA proteins:

Substrate Preferences:

  • Most CSLA proteins primarily utilize GDP-mannose to synthesize β-1,4-mannans

  • Some CSLA members can additionally use GDP-glucose to form glucomannans when both substrates are present

  • Certain CSLA proteins (e.g., AtCSLA7) can produce β-glucan when supplied with GDP-glucose alone

CSLA11 from rice is predicted to have similar substrate preferences, but may exhibit unique specificities that require experimental verification. Comparative analysis should:

  • Test activity with GDP-mannose alone to assess mannan synthase activity

  • Test activity with GDP-glucose alone to determine if glucan synthesis occurs

  • Test activity with both substrates to assess glucomannan formation and the mannose:glucose ratio in the product

  • Examine chain length preferences and crystallization properties of the products

The substrate specificity of CSLA11 likely evolved in response to specific cell wall requirements in rice and may differ from CSLA proteins in other species like Arabidopsis, which have been more extensively characterized.

What genetic approaches can be used to study CSLA11 function in planta?

Several genetic approaches can be employed to investigate CSLA11 function in rice plants:

InDel Marker Development:

  • Design InDel (insertion/deletion) markers based on sequence polymorphisms in the CSLA11 gene region between different rice subspecies

  • These markers can be used to track CSLA11 alleles in genetic crosses and mapping populations

  • The markers should be designed to be co-dominant and produce clear bands distinguishable on polyacrylamide gels

CRISPR/Cas9 Gene Editing:

  • Design guide RNAs targeting specific regions of the CSLA11 coding sequence

  • Generate knockout or specific mutations to assess loss-of-function phenotypes

  • Create precise modifications to study structure-function relationships

Overexpression Studies:

  • Clone the full CSLA11 coding sequence into plant expression vectors

  • Transform rice plants to overexpress CSLA11 under constitutive or tissue-specific promoters

  • Analyze changes in cell wall composition, particularly mannan content

Complementation Assays:

  • Transform csla11 mutants with wild-type or modified CSLA11 constructs

  • Assess the ability of different constructs to restore wild-type phenotypes

  • Identify critical domains and residues required for function

These approaches can be combined with cell wall compositional analysis to establish direct links between CSLA11 function and specific changes in mannan content or structure in rice cell walls.

How can structural predictions inform mutagenesis studies of CSLA11?

While the crystal structure of CSLA11 has not been determined, structural predictions based on sequence analysis and homology modeling can guide targeted mutagenesis studies:

Key Domains for Mutagenesis:

  • Catalytic Domain:

    • The D,D,D,QXXRW motif is typically essential for catalytic activity in glycosyltransferases

    • Mutations in these residues often abolish or severely reduce enzymatic activity

    • Conservative substitutions can provide insights into the specific roles of these residues

  • Transmembrane Domains:

    • CSLA11 contains multiple predicted transmembrane domains that anchor it in the Golgi membrane

    • Mutations affecting membrane topology may disrupt proper protein localization and function

  • Substrate Binding Sites:

    • Residues involved in GDP-sugar binding can be predicted based on sequence alignment with other characterized glycosyltransferases

    • Mutations in these regions may alter substrate specificity or catalytic efficiency

Experimental Approach for Structure-Function Analysis:

  • Generate a series of CSLA11 variants with specific mutations in predicted functional domains

  • Express these variants in heterologous systems (E. coli or insect cells)

  • Assess protein expression, stability, and subcellular localization

  • Measure enzymatic activity with different substrates

  • Analyze product profiles (chain length, composition) for each variant

This approach can identify critical residues for CSLA11 function and potentially engineer variants with altered properties for specific research applications.

What is the evolutionary relationship between CSLA11 and other glycosyltransferases in the Oryza genus?

CSLA11 belongs to the cellulose synthase-like gene family, which is part of the larger glycosyltransferase 2 family. Evolutionary analysis provides insights into its origin and functional specialization:

Phylogenetic Context:

  • The CSLA gene family in rice (Oryza sativa) likely evolved from ancient gene duplication events

  • CSLA genes are present across the Oryza genus, with variation in copy number and sequence among different species and subspecies

  • CSLA11 in japonica rice may have specific adaptations distinct from its counterparts in indica or other Oryza species

Evolutionary Significance:

  • Differences in CSLA sequences between rice subspecies (japonica, indica) may reflect adaptation to different environmental conditions

  • These differences can be identified using genetic markers such as InDels (insertions/deletions)

  • Comparative genomic approaches can reveal selection pressures acting on CSLA11 during rice domestication

When studying CSLA11 evolution, it's important to consider the complex evolutionary history of rice itself. The Oryza sativa complex includes multiple subspecies that have undergone reproductive isolation and developed distinct genetic features, which likely affected the evolution of cell wall-related genes like CSLA11 .

How does CSLA11 contribute to cell wall diversity across rice subspecies?

Cell wall composition varies significantly across rice subspecies, and CSLA11 may play a role in this diversity:

Subspecies Variation:

  • Japonica rice (including tropical japonica or javanica) has distinct cell wall characteristics compared to indica rice

  • These differences may relate to variations in mannan content or structure, potentially influenced by CSLA11 activity

  • Genetic diversity in CSLA11 can be tracked using InDel markers developed specifically for distinguishing between subspecies

Functional Implications:

  • Variations in CSLA11 sequence or expression may contribute to differences in:

    • Stress tolerance (drought, salinity, pathogen resistance)

    • Grain quality characteristics

    • Plant architecture and biomass properties

    • Adaptability to different growing conditions

Investigating CSLA11 diversity across the Oryza sativa complex could provide valuable insights into the genetic basis of cell wall variation and its adaptive significance. This knowledge could be leveraged for rice improvement programs targeting specific traits related to cell wall properties.

What are common challenges in detecting CSLA11 enzymatic activity and how can they be addressed?

Researchers often encounter several challenges when assessing the enzymatic activity of recombinant CSLA11:

Challenge 1: Low Enzymatic Activity

  • Potential causes: Improper protein folding, absence of cofactors, suboptimal reaction conditions

  • Solutions:

    • Test multiple expression systems (E. coli, insect cells) to improve protein folding

    • Optimize buffer components (add divalent cations like Mg²⁺ or Mn²⁺)

    • Vary temperature and pH systematically to find optimal conditions

    • Include stabilizing agents like glycerol or BSA in the reaction mixture

Challenge 2: Product Detection Difficulties

  • Potential causes: Low product yield, product precipitation, inadequate detection methods

  • Solutions:

    • Extend reaction time to allow product accumulation

    • If products precipitate, analyze both soluble and insoluble fractions

    • Use sensitive detection methods like HPAEC-PAD optimized for mannan oligomers

    • For very low yields, consider radiochemical assays using ¹⁴C-labeled substrates

Challenge 3: Substrate Availability

  • Potential causes: Limited commercial availability of GDP-mannose, GDP degradation

  • Solutions:

    • Prepare fresh GDP-mannose from mannose-1-phosphate using GDP-mannose pyrophosphorylase

    • Store nucleotide sugars at -80°C in small aliquots to minimize freeze-thaw cycles

    • Include phosphatase inhibitors to prevent GDP-mannose degradation

Challenge 4: Product Characterization

  • Potential causes: Complex mixture of products with different chain lengths

  • Solutions:

    • Use size-exclusion chromatography or HPAEC-PAD with appropriate standards

    • Employ enzymatic digestion with specific mannanases to confirm product identity

    • Consider advanced techniques like NMR for detailed structural characterization

How can CSLA11 be integrated into synthetic biology approaches for designer cell wall polysaccharides?

CSLA11's ability to synthesize mannans offers opportunities for synthetic biology applications:

In Vitro Synthesis Platform:

  • Express and purify active CSLA11 in sufficient quantities

  • Establish a cell-free reaction system with controlled conditions

  • Supply specific acceptors to direct product formation

  • Combine with other glycosyltransferases for synthesis of complex structures

Design Principles for Custom Mannans:

  • Control chain length by adjusting reaction time and conditions

  • Modify product solubility by controlling degree of polymerization (DP)

  • Generate crystalline mannans for material science applications

  • Create labeled mannans for tracking cell wall assembly

Applications of Designer Mannans:

  • Probes for studying cell wall architecture and assembly

  • Standards for analytical methods development

  • Substrates for testing glycosyl hydrolase specificity

  • Biomaterials with tailored properties

By understanding the reaction parameters that influence CSLA11 activity and product formation, researchers can develop systems for producing mannans with specific structural features for diverse applications in plant biology and beyond.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.