Recombinant Oryza sativa subsp. japonica Probable mannan synthase 2 (CSLA2)

Shipped with Ice Packs
In Stock

Description

Introduction to CSLA2

Recombinant Oryza sativa subsp. japonica Probable mannan synthase 2 (CSLA2) is a glycosyltransferase enzyme belonging to the cellulose synthase-like A (CSLA) family. Expressed in E. coli and purified with an N-terminal His tag, this protein (UniProt ID: Q7PC67) synthesizes β-linked mannans and glucomannans, critical hemicelluloses in plant cell walls . Its full-length sequence (580 amino acids) includes conserved domains for nucleotide sugar binding and polymer elongation .

Biochemical Function and Activity

CSLA2 catalyzes the polymerization of GDP-mannose and GDP-glucose into β-linked mannans and glucomannans, respectively. Key findings include:

  • Processive β-glycosyltransferase activity, forming polymers via nucleotide sugar incorporation .

  • No epimerization of substrates (e.g., GDP-mannose → GDP-glucose) observed in in vitro assays .

Enzyme Specificity:

  • Produces polymers resistant to protease, cellulase, or lichenase, but digestible by endo-β-mannanase .

Role in Arabidopsis thaliana

While the focus here is on rice CSLA2, studies in Arabidopsis provide insights into CSLA family functions:

FunctionObservationSource
Stem Glucomannan SynthesisCSLA2, CSLA3, and CSLA9 are essential for glucomannan production in inflorescence stems .
Seed Mucilagecsla2 mutants exhibit thinner adherent mucilage halos and reduced mannosyl/glucosyl content .
EmbryogenesisOverexpression causes defective embryogenesis, suggesting a role in developmental regulation .

Conservation in Rice:

  • Rice CSLA2 shares structural and functional homology with Arabidopsis CSLA proteins, indicating conserved roles in hemicellulose biosynthesis .

Heterologous Expression and In Vitro Activity

Key Findings:

  1. Insect Cell Systems:

    • Recombinant CSLA proteins (e.g., Arabidopsis CSLA9) produce β-mannans, β-glucans, or glucomannans depending on substrate availability .

    • CSLA2 co-expression with mannanases (e.g., AtMAN2/5) enhances polymer solubility in yeast, suggesting intracellular processing .

  2. Substrate Flexibility:

    • Single CSLA enzymes can synthesize diverse β-glycans, implying substrate competition or regulatory mechanisms .

Biotechnological Potential

ApplicationDetails
Hemicellulose EngineeringModifying CSLA2 activity to tailor glucomannan structure for biofuel or material science .
Functional GenomicsStudying CSLA2 interactions with mannanases to optimize polysaccharide production .
Structural BiologyResolving crystal structures to elucidate substrate binding and catalytic mechanisms .

Future Directions:

  • Investigating CSLA2’s role in rice cell wall architecture and stress responses.

  • Leveraging recombinant CSLA2 for industrial-scale production of β-glycans.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time information, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLA2; Os10g0406400; LOC_Os10g26630; OSJNBa0060A14.12; Probable glucomannan 4-beta-mannosyltransferase 2; Cellulose synthase-like protein A2; OsCslA2; Glucomannan synthase; Mannan synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-580
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA2
Target Protein Sequence
MSTNGGAPSQKRSWLPSRPLLTTTTQTYPPPLLPFKKLHAPPTAARRSLPPAASKPMASS SSSSLPAAWAAAVRAWAVAPALRAAVWACLAMSAMLVAEAAWMGLASLAAAAARRLRGYG YRWEPMAAPPDVEAPAPAPAEFPMVLVQIPMYNEKEVYKLSIGAACALTWPPDRIIIQVL DDSTDPFVKELVELECKEWASKKINIKYEVRNNRKGYKAGALRKGMEHTYAQLCDFVAIF DADFEPESDFLLKTMPYLLHNPKIALVQTRWEFVNYNVCLMTRIQKMSLDYHFKVEQESG SFMHAFFGFNGTAGVWRVSAINQSGGWKDRTTVEDMDLAVRASLKGWEFLYVGDIRVKSE LPSTFQAYRHQQHRWTCGAANLFRKMAWEIITNKEVSMWKKYHLLYSFFFVRRAIAPILT FLFYCIVIPLSAMVPEVTIPVWGLVYIPTAITIMNAIRNPGSVHLMPFWILFENVMAMHR MRAALSGLLETARANDWVVTEKVGDQVKDELDVPLLEPLKPTECAERIYIPELLLALYLL ICASYDFVLGNHKYYIYIYLQAVAFTVMGFGFVGTRTPCS
Uniprot No.

Target Background

Function
This protein is likely a mannan synthase exhibiting 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product serves as the backbone for galactomannan synthesis mediated by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharide found in plant cell walls.
Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Oryza sativa CSLA2 and what is its function?

Oryza sativa CSLA2 belongs to the cellulose synthase-like A (CslA) family of proteins, which are part of the larger cellulose synthase and cellulose synthase-like gene superfamily (CESA/CSL). CSLA2 functions as a glycosyltransferase that catalyzes the biosynthesis of β-1,4-linked mannan and glucomannan polysaccharides, which are important components of plant cell walls .

Biochemical studies have demonstrated that CSLA proteins, including rice CSLA2, use GDP-mannose to synthesize mannans and a combination of GDP-mannose and GDP-glucose to produce glucomannans. These activities have been confirmed through in vitro enzyme assays using recombinant proteins expressed in heterologous systems .

How is CSLA2 classified within the rice CESA/CSL gene superfamily?

The CESA/CSL superfamily in rice has been classified into two main clusters based on phylogenetic analysis and motif constitution:

  • Cluster I: Contains primarily CESA genes

  • Cluster II: Contains CSL genes, including CSLA2

This classification reveals that gene duplication events contributed significantly to the expansion of this superfamily in rice. Interestingly, genes in Cluster I and II are mainly attributed to tandem and segmental duplication, respectively .

The CSLA genes are present throughout land plants, from bryophytes to angiosperms, reflecting their evolutionary importance. Their conserved function across diverse species suggests they play fundamental roles in plant cell wall biosynthesis .

What expression patterns have been observed for CSLA2 in rice?

Expression analysis of the CESA/CSL superfamily in rice has revealed tissue-specific expression patterns throughout the plant's life cycle. While comprehensive microarray data covering 33 tissue samples has shown variable expression patterns for CSL genes in general, specific members of each CSL family (including A1, C9, D2, E1, F6, and H1) are expressed in all tissues examined .

Many CSL genes show tissue-specific expression, particularly in reproductive tissues like stamen and in developing structures like radicles. To determine the specific expression pattern of CSLA2, researchers would analyze data from platforms such as the CREP database or rice transcriptome projects using Affymetrix Rice GeneChip microarrays .

What expression systems are most effective for producing recombinant CSLA2?

For the functional characterization of CSLA proteins, insect cell expression systems have proven particularly effective. Specifically, Drosophila Schneider 2 (S2) cells have been successfully used to express recombinant CSLA proteins from various plant species, including representatives from monocots, dicots, gymnosperms, and bryophytes .

The general procedure involves:

  • Cloning the CSLA2 coding sequence into an appropriate expression vector

  • Transforming S2 cells with the construct

  • Detecting the recombinant protein by immunoblot analysis

  • Isolating membrane fractions for enzyme activity assays

Membrane fractions from cells expressing CSLA proteins show significantly elevated mannan and glucomannan synthase activities compared to control cells expressing GFP .

How can mannan and glucomannan synthase activities be measured for recombinant CSLA2?

The enzymatic activities of recombinant CSLA2 can be assessed through in vitro assays measuring the incorporation of sugar nucleotides into polysaccharide products. The general protocol includes:

  • Prepare membrane fractions from cells expressing CSLA2

  • Incubate membrane fractions with:

    • GDP-mannose (for mannan synthase activity)

    • GDP-mannose + GDP-glucose (for glucomannan synthase activity)

  • Detect and quantify polysaccharide synthesis

  • Confirm product identity through enzymatic digestions:

    • Mannan products are susceptible to endo-β-mannanase but not endo-β-glucanase

    • Glucomannan products are digestible by both endo-β-mannanase and endo-β-glucanase

This differential susceptibility to specific glycosyl hydrolases provides conclusive evidence for the identity of the synthesized products.

What is the optimal field experimental design for studying CSLA2 mutants in rice?

When conducting field experiments with rice CSLA2 mutants, several key experimental design factors should be considered:

Plot Size and Shape:

  • The optimal plot size depends on soil heterogeneity

  • When soil heterogeneity is patchy, larger plots are recommended

  • Plot shape is less critical when soil variation is uniform in all directions

Replication:

  • Four replications are commonly used in rice field experiments at IRRI

  • The required number of replications depends on the coefficient of variation (CV)

  • Typical CVs for rice yield trials range from 8-12%

Experimental Design:

  • Complete block designs are suitable for simple experiments with few treatments

  • Incomplete block designs are preferred for experiments with many treatments

  • Split-plot designs may be appropriate for factorial experiments

Number of ReplicationsEstimated Standard Error (%)
CV = 8%CV = 10%CV = 12%
25.77.18.5
44.05.06.0
63.34.14.9

Table 1: Relationship between number of replications and estimated standard error at different coefficients of variation for rice field experiments .

How is substrate specificity determined for CSLA2?

Determining substrate specificity for CSLA2 involves systematic in vitro enzyme assays with different sugar nucleotide donors. The procedure includes:

  • Prepare membrane fractions from cells expressing recombinant CSLA2

  • Set up reaction mixtures containing:

    • Single substrates (e.g., GDP-mannose, GDP-glucose)

    • Substrate combinations (e.g., GDP-mannose + GDP-glucose)

  • Analyze reaction products using:

    • Specific glycosyl hydrolases (endo-β-mannanase and endo-β-glucanase)

    • Structural characterization methods (methylation analysis, NMR)

Research has shown that recombinant CSLA proteins, including those from rice, catalyze the synthesis of β-mannans when provided with GDP-mannose alone and glucomannans when supplied with both GDP-mannose and GDP-glucose .

How do mutations in CSLA2 affect cell wall composition in rice?

Investigating the effects of CSLA2 mutations on rice cell wall composition requires:

  • Generation of CSLA2 mutants (T-DNA insertion, CRISPR/Cas9, etc.)

  • Comprehensive cell wall analysis:

    • Monosaccharide composition (particularly mannose content)

    • Polysaccharide fractionation and analysis

    • Immunolabeling with mannan-specific antibodies

  • Comparison with wild-type plants under similar growth conditions

While specific data for rice CSLA2 mutants is limited in the provided search results, studies in other plant species have shown that mutations in CSLA genes can alter mannan content in cell walls, potentially affecting various aspects of plant development and physiology .

What co-expression patterns have been observed for CSLA2 and other cell wall-related genes?

Co-expression analysis can reveal functional relationships between CSLA2 and other genes involved in cell wall biosynthesis. The CESA/CSL superfamily in rice has been studied using:

  • Microarray data from 33 tissue samples covering the entire rice life cycle

  • Hierarchical clustering to identify genes with similar expression patterns

  • Analysis of co-expressed gene functions

Research has identified genes extensively co-expressed with CESA/CSL members, including OsBC1L, which may be involved in cell wall synthesis networks. This co-expression analysis provides insights into the functional context of CSLA2 within broader metabolic networks .

How conserved is CSLA2 function across plant species?

Functional conservation of CSLA proteins has been extensively studied across diverse plant lineages:

  • CSLA proteins from mono- and dicotyledonous angiosperms, gymnosperms, and bryophytes have been expressed in insect cells

  • Each recombinant CSLA protein demonstrated mannan and glucomannan synthase activities in vitro

  • Products from each species showed similar susceptibility patterns to glycosyl hydrolases:

    • Mannan products were digested by endo-β-mannanase but not endo-β-glucanase

    • Glucomannan products were susceptible to both enzymes

This remarkable conservation of enzymatic function across evolutionarily distant plant species strongly indicates that mannan synthesis is a fundamental and ancient process in land plants .

How do expression patterns of CSLA genes vary between rice and other species?

Transcriptomic analyses have revealed both similarities and differences in CSLA gene expression patterns across plant species:

  • In Arabidopsis, CSLA transcripts display tissue-specific expression in vegetative and floral tissues

  • Similarly, in loblolly pine (Pinus taeda), CSLA genes show distinct expression patterns across different tissues

  • In rice, microarray analysis of 33 tissue samples has revealed variable expression patterns for CSL genes, with some members expressed ubiquitously and others showing tissue-specific expression

These expression patterns likely reflect the specialized roles of different CSLA family members in cell wall biosynthesis and other cellular processes across diverse plant species.

What insights do phylogenetic analyses provide about the evolution of the CSLA gene family?

Phylogenetic analyses of the CESA/CSL superfamily have revealed important evolutionary insights:

  • CSLA genes are present in all lineages of land plants analyzed to date

  • The rice CESA/CSL superfamily has expanded largely through gene duplication events:

    • Cluster I (primarily CESA genes) expanded mainly through tandem duplication

    • Cluster II (including CSLA genes) expanded primarily through segmental duplication

This evolutionary pattern suggests that the diversification of CSLA genes has contributed to the adaptation of different plant lineages, potentially enabling the synthesis of specialized cell wall structures and compositions.

What are the most effective approaches for analyzing mannans in rice tissues?

Comprehensive analysis of mannans in rice tissues requires multiple complementary approaches:

  • Glycan Microarray Analysis:

    • Provides information on the distribution of mannans across different tissues

    • Can detect even low abundance polysaccharides

    • Allows comparison between tissues and developmental stages

  • Immunolabeling Techniques:

    • Using mannan-specific antibodies or carbohydrate-binding modules

    • Enables visualization of mannan distribution at cellular and subcellular levels

    • Can be combined with confocal or electron microscopy for detailed localization studies

  • Biochemical Analysis:

    • Fractionation of cell wall polysaccharides

    • Linkage analysis to determine glycosidic bond types

    • Monosaccharide composition analysis to quantify mannose content

These approaches have revealed that mannans are present throughout plant tissues and are particularly abundant in specific structures like flowers, siliques, and stems in Arabidopsis .

How can transcriptional regulation of CSLA2 be studied effectively?

Investigating the transcriptional regulation of CSLA2 requires a multi-faceted approach:

  • Promoter Analysis:

    • Isolation and characterization of the CSLA2 promoter region

    • Identification of cis-regulatory elements through bioinformatic analysis

    • Validation using reporter gene constructs (e.g., CSLA2 promoter::GUS)

  • Transcription Factor Identification:

    • Yeast one-hybrid screening to identify proteins binding to the CSLA2 promoter

    • Co-expression analysis to identify transcription factors with expression patterns similar to CSLA2

    • ChIP-seq to identify in vivo binding of transcription factors to the CSLA2 promoter

  • Environmental and Developmental Regulation:

    • Analysis of CSLA2 expression under different environmental conditions

    • Examination of expression changes during development

    • Comparison of expression patterns between wild-type and regulatory mutants

These approaches can provide insights into how CSLA2 expression is coordinated with other cell wall-related genes and regulated in response to developmental and environmental cues.

What are the methodological considerations for creating and phenotyping CSLA2 knockout rice lines?

Creating and phenotyping CSLA2 knockout lines require careful experimental design:

  • Generation of Knockout Lines:

    • CRISPR/Cas9-mediated genome editing targeting CSLA2 coding sequences

    • Screening and confirmation of mutations by sequencing

    • Selection of homozygous knockout lines for further analysis

  • Experimental Design for Phenotyping:

    • Proper blocking to account for environmental variation

    • Adequate replication (typically 4 replications for rice field experiments)

    • Appropriate plot size based on soil heterogeneity

  • Comprehensive Phenotypic Analysis:

    • Growth parameters (plant height, tiller number)

    • Yield components (grain number, grain weight)

    • Cell wall composition analysis

    • Stress response evaluation

    • Microscopic analysis of cell wall structure

  • Data Collection Methodology:

    • Standardized sampling procedures

    • Statistical analysis to determine significant differences

    • Correlation analysis between phenotypic traits and molecular/biochemical changes

These methodological considerations ensure robust and reproducible results when characterizing the functional roles of CSLA2 in rice growth, development, and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.