Recombinant Oryza sativa subsp. japonica Probable mannan synthase 3 (CSLA3)

Shipped with Ice Packs
In Stock

Description

Functional Insights

CSLA3 belongs to the cellulose synthase-like A (CSLA) family, which catalyzes the polymerization of β-1,4-linked mannan and glucomannan backbones . Experimental studies demonstrate:

  • Enzymatic Activity:

    • Recombinant CSLA3 utilizes GDP-mannose and GDP-glucose to synthesize β-mannan and glucomannan, respectively .

    • Single CSLA proteins can incorporate both mannose and glucose into polysaccharide chains, indicating bifunctional activity .

StudyKey Findings
Heterologous expressionCSLA3 produces β-linked mannan when supplied with GDP-mannose .
Substrate specificityExhibits dual specificity for GDP-mannose and GDP-glucose, forming heteropolymers .
Genetic evidenceArabidopsis CSLA mutants show reduced glucomannan levels, confirming in vivo relevance .

Biochemical Properties

The recombinant protein is produced with high purity (>90% via SDS-PAGE) and specific storage requirements to maintain stability :

ParameterSpecification
Purity≥90% (SDS-PAGE)
FormLyophilized powder
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionTris/PBS buffer with 6% trehalose (pH 8.0); glycerol (5–50%) recommended for stability

Applications and Research Relevance

  • Plant Cell Wall Studies: CSLA3 is essential for understanding the role of mannans in cell wall integrity and plant development .

  • Biotechnological Applications: Engineered mannan synthases could optimize biomass for biofuel production or functional food additives .

  • Antibody Production: Polyclonal antibodies against CSLA3 enable protein localization and activity assays in rice tissues .

Comparative Analysis with Related Enzymes

While CSLA3 specializes in mannan synthesis, other cellulose synthase-like (CSL) families have distinct roles:

CSL FamilyFunctionSubstrate Specificity
CSLAβ-mannan/glucomannan synthaseGDP-mannose, GDP-glucose
CSLCXyloglucan synthaseUDP-glucose
CSLDInvolved in mannan synthesis (unexpectedly)GDP-mannose (requires protein complexes)

Future Directions

Further research should explore:

  • Structural characterization of CSLA3 to identify catalytic residues .

  • Genetic engineering of rice to modulate mannan content for agricultural or industrial applications .

  • Interactions with other CSL proteins to elucidate polysaccharide synthesis complexes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CSLA3; Os06g0230100; LOC_Os06g12460; P0525F01.26; Probable glucomannan 4-beta-mannosyltransferase 3; Cellulose synthase-like protein A3; OsCslA3; Glucomannan synthase; Mannan synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA3
Target Protein Sequence
MAMAGADGPTAGAAAAVRWRGGESLLLLLLRWPSSAELVAAWGAARASAVAPALAAASAA CLALSAMLLADAVLMAAACFARRRPDRRYRATPLGAGAGADDDDDDEEAGRVAYPMVLVQ IPMYNEREVYKLSIGAACGLSWPSDRLIVQVLDDSTDPTVKGLVELECKSWGNKGKNVKY EVRNTRKGYKAGALKEGLLRDYVQQCNYVAIFDADFQPEPDFLLRTIPYLVRNPQIGLVQ AHWEFVNTSECLMTRIQKMTLHYHFKVEQEGGSSTFAFFGFNGTAGVWRISALEEAGGWK DRTTVEDMDLAVRAGLKGWKFVYLADVKVKSELPSNLKTYRHQQHRWTCGAANLFRKVGA EILFTKEVPFWWKFYLLYSFFFVRKVVAHVVPFMLYCVVIPFSVLIPEVTVPVWGVVYVP TTITLLHAIRNTSSIHFIPFWILFENVMSFHRTKAMFIGLLELGGVNEWVVTEKLGNGSN TKPASQILERPPCRFWDRWTMSEILFSIFLFFCATYNLAYGGDYYFVYIYLQAIAFLVVG IGFCGTISSNS
Uniprot No.

Target Background

Function

Probable mannan synthase exhibiting 4-beta-mannosyltransferase activity on mannan using GDP-mannose as a substrate. The resulting beta-1,4-mannan serves as the backbone for galactomannan synthesis via galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide found in plant cell walls.

Database Links

KEGG: osa:4340570

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA3 and what is its functional significance in rice?

CSLA3 (Cellulose synthase-like protein A3) is a glycosyltransferase belonging to the CSLA family in Oryza sativa subsp. japonica, functioning as a probable mannan synthase involved in hemicellulose biosynthesis in plant cell walls . The enzyme is encoded by the CSLA3 gene, identified by the ordered locus names Os06g0230100 and LOC_Os06g12460, with the ORF name P0525F01.26 . CSLA3 catalyzes the formation of β-1,4-linked mannan polymers using GDP-mannose as the sugar donor substrate, contributing to the structural integrity and functional properties of rice cell walls.

Functionally, CSLA3 contributes to the synthesis of mannans and glucomannans, which serve as cross-linking glycans in the rice cell wall matrix. These hemicelluloses interact with cellulose microfibrils and other wall components to determine mechanical properties, affecting plant growth, development, and responses to environmental stresses. Mannans may also function as carbohydrate reserves in some tissues and potentially play roles in cell signaling pathways. Understanding CSLA3 is crucial for elucidating the molecular mechanisms underlying cell wall architecture in rice, with implications for crop improvement and biomass utilization.

Researchers investigating CSLA3 typically employ molecular genetics approaches combined with biochemical characterization to determine its precise role in different rice tissues and developmental stages. Transcript profiling across various tissues reveals tissue-specific expression patterns that correlate with distinct cell wall compositions and developmental programs in rice. The enzyme's activity can be assayed in vitro using purified recombinant protein and appropriate substrates to characterize its catalytic properties and substrate specificities.

How does the structure of CSLA3 relate to its enzymatic function?

CSLA3 exhibits a multi-domain structure characteristic of membrane-bound glycosyltransferases, with distinct regions responsible for substrate binding, catalysis, and membrane anchoring . The complete amino acid sequence comprises 551 amino acids, containing multiple transmembrane domains that anchor the protein to the Golgi apparatus membrane . The catalytic domain contains conserved DXD motifs essential for coordinating divalent metal ions (typically Mg²⁺ or Mn²⁺) that facilitate the sugar transfer reaction.

Analysis of the protein sequence reveals regions corresponding to the GT-A fold typical of many glycosyltransferases, featuring a nucleotide-binding domain that recognizes GDP-mannose. Hydrophobicity analysis of the amino acid sequence indicates several membrane-spanning regions that position the catalytic domain on the luminal side of the Golgi apparatus . This topology is crucial for the enzyme's function, as it allows the newly synthesized mannan chains to be directly incorporated into the developing cell wall components being processed through the secretory pathway.

While the crystal structure of rice CSLA3 has not been fully determined, homology modeling based on related glycosyltransferases provides insights into its structural features. The catalytic site likely forms a pocket that accommodates the GDP-mannose donor and positions it optimally for transfer to the growing carbohydrate chain. Structure-function analysis through site-directed mutagenesis of conserved residues can identify amino acids critical for substrate binding, catalysis, and product specificity, offering further understanding of the molecular mechanisms underlying CSLA3 activity.

What experimental approaches are effective for studying CSLA3 expression patterns?

Multiple complementary techniques can effectively characterize CSLA3 expression patterns across different tissues, developmental stages, and environmental conditions. Quantitative RT-PCR remains a gold standard for measuring transcript levels with high sensitivity and specificity. Primers should be designed to distinguish CSLA3 from other CSLA family members, targeting unique regions of the transcript. For comprehensive expression profiling, RNA-seq provides genome-wide context for CSLA3 expression relative to other cell wall-related genes.

For spatial resolution of expression patterns, in situ hybridization using CSLA3-specific probes can localize transcripts to specific cell types within tissues. This approach is particularly valuable for understanding the relationship between CSLA3 expression and cell wall differentiation in specialized tissues. Alternatively, transgenic rice lines carrying CSLA3 promoter-reporter constructs (such as promoter:GUS or promoter:GFP) enable visualization of expression patterns in intact tissues and can be used to monitor expression dynamics in response to developmental or environmental cues.

At the protein level, immunolocalization using antibodies specific to CSLA3 provides information about protein abundance and subcellular localization. For studying rapid changes in expression, rice protoplast transient expression systems with fluorescent protein fusions can monitor real-time changes in response to treatments. When combined with techniques like chromatin immunoprecipitation sequencing (ChIP-seq), researchers can identify transcription factors and regulatory elements controlling CSLA3 expression, providing mechanistic insights into its transcriptional regulation in different contexts.

How can native and recombinant CSLA3 be distinguished in experimental systems?

Distinguishing between native and recombinant CSLA3 in experimental systems requires strategic approaches at the molecular and biochemical levels. For recombinant expression, incorporation of epitope tags (such as His6, FLAG, or HA) provides the simplest method for specific detection . These tags enable selective identification using commercially available antibodies in techniques such as western blotting, immunoprecipitation, or immunolocalization. When selecting tags, C-terminal positioning often minimizes interference with signal peptide function and protein folding for membrane proteins like CSLA3.

At the genetic level, introducing silent mutations that create unique restriction sites in the recombinant CSLA3 cDNA allows distinction through restriction fragment length polymorphism (RFLP) analysis without altering protein sequence. For CRISPR/Cas9-mediated knock-in approaches, genomic PCR with primers spanning the insertion junctions can verify the presence of recombinant constructs and distinguish them from the native gene . Similarly, RT-PCR with primers specific to unique junctions or epitope tag sequences can differentiate between native and recombinant transcripts.

Functionally, engineered variants of CSLA3 with altered kinetic properties, substrate specificities, or inhibitor sensitivities provide another approach to distinction. Mass spectrometry-based proteomics offers the most precise method for discrimination, as even single amino acid substitutions can be detected through peptide mass fingerprinting. Selected reaction monitoring (SRM) mass spectrometry can further enable precise quantification of the relative abundance of native versus recombinant CSLA3 within the same sample, providing valuable data for studying the effects of recombinant protein expression on native CSLA3 functions.

What are optimal strategies for recombinant CSLA3 expression in plant-based systems?

Plant-based expression systems offer significant advantages for recombinant CSLA3 production, particularly for maintaining native post-translational modifications and proper protein folding. Homologous expression in rice cells represents an ideal approach, leveraging the endogenous cellular machinery adapted for CSLA3 processing. Rice suspension cultures established from embryogenic calli provide a scalable platform for CSLA3 expression with appropriate glycosylation and membrane insertion capabilities . These cultures can be maintained in defined media and scaled to different volumes based on experimental requirements.

For controlled expression, the rice αAmy3 promoter system has demonstrated efficiency in driving recombinant protein expression in response to sugar starvation . This inducible system allows for temporal control of CSLA3 expression, potentially mitigating toxic effects of overexpression. Experimental data from similar recombinant protein expression studies in rice cells have shown that sugar depletion can strongly upregulate the αAmy3 promoter, resulting in significant protein accumulation . For CSLA3 expression, constructs can be designed to include the αAmy3 promoter and signal peptide fused to the CSLA3 coding sequence, directing the recombinant protein through the secretory pathway.

Stable transformation can be achieved through Agrobacterium-mediated methods or particle bombardment, with selection based on antibiotic resistance markers . For precise genomic integration, CRISPR/Cas9-mediated knock-in approaches targeting specific loci can minimize position effects and ensure consistent expression levels . This approach has demonstrated transformation efficiencies of approximately 13.5% in rice calli for targeted gene insertions . Following transformation, rigorous screening through genomic PCR, RT-PCR, and western blotting is essential to identify lines with optimal expression characteristics for subsequent experimental applications.

How can CRISPR/Cas9 technology be applied to study CSLA3 function in rice?

CRISPR/Cas9 technology offers versatile approaches for investigating CSLA3 function through precise genome modifications. For loss-of-function studies, CRISPR/Cas9-mediated knockout can be achieved by designing guide RNAs (gRNAs) targeting exonic regions of CSLA3, creating frameshift mutations or premature stop codons. Multiple gRNAs can be designed to target different exons simultaneously, increasing the likelihood of functional disruption. The resulting mutants provide valuable materials for analyzing phenotypic consequences of CSLA3 deficiency on cell wall composition, plant development, and stress responses.

For structure-function analyses, precision editing through homology-directed repair enables introduction of specific amino acid substitutions in catalytic domains or other functional regions. This approach can generate an allelic series with varying levels of CSLA3 activity or altered substrate specificities. Knock-in strategies similar to those used for recombinant protein expression can be adapted to introduce reporter tags or regulatory elements at the endogenous CSLA3 locus . This involves designing a CRISPR plasmid with gRNA targeting the desired genomic location and a donor plasmid carrying the modification sequence flanked by homology arms .

Transformation can be performed through particle bombardment of immature embryo-derived calli with DNA-coated gold particles, achieving transformation efficiencies around 13.5% for targeted insertions . Selection of transformed cells using appropriate markers (such as hygromycin resistance) followed by regeneration of plants allows the development of stable lines for phenotypic analysis . For studying CSLA3 in specific cell types or developmental contexts, tissue-specific promoters driving Cas9 expression can restrict editing to particular cells or developmental stages, enabling more nuanced analysis of CSLA3 function in complex developmental programs.

What purification strategies yield functional recombinant CSLA3 protein?

Purifying functional CSLA3 requires specialized approaches due to its membrane-associated nature and specific requirements for maintaining enzymatic activity. The purification workflow begins with optimized extraction conditions using buffers containing mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS at 0.5-1%) to solubilize membrane-bound CSLA3 without denaturation. Initial extraction should incorporate protease inhibitors, reducing agents, and glycerol to stabilize the protein during solubilization from membrane fractions.

Affinity chromatography provides the most efficient initial purification step, particularly when recombinant CSLA3 includes an affinity tag . For His-tagged constructs, immobilized metal affinity chromatography using Ni-NTA resin with optimized imidazole concentrations (typically 20-40 mM in wash buffers and 250-300 mM for elution) yields good preliminary purification. Buffer optimization is critical, with pH maintenance between 7.0-7.5 and inclusion of appropriate detergent concentrations above critical micelle concentration to prevent protein aggregation.

Subsequent purification steps typically involve size exclusion chromatography using matrices like Superdex 200 to separate CSLA3 from aggregates and remaining contaminants. For applications requiring higher purity, ion exchange chromatography can provide additional resolution. Throughout the purification process, functional assays should be performed to monitor enzymatic activity, as activity loss often occurs during purification of membrane proteins. Activity conservation can be enhanced by adding stabilizing agents like specific lipids, glycerol (10-20%), and appropriate cofactors (Mg²⁺ or Mn²⁺) to all buffers. For structural studies or antibody production, alternative purification strategies may include immunoaffinity chromatography using antibodies against CSLA3 or tags.

What analytical methods accurately measure CSLA3 enzymatic activity and product characteristics?

Comprehensive characterization of CSLA3 activity requires multiple analytical approaches to measure reaction kinetics and product properties. Radiometric assays using 14C-labeled GDP-mannose provide the most sensitive method for quantifying mannan synthesis activity. In this approach, incorporation of radioactive mannose into acid-insoluble or ethanol-precipitable products is measured by scintillation counting. Reaction conditions typically require optimization of pH (6.5-7.0), divalent cation concentration (5-10 mM Mg²⁺ or Mn²⁺), and substrate concentrations (GDP-mannose at 0.1-1 mM).

For detailed product characterization, enzymatic hydrolysis of the synthesized mannans followed by analysis using high-performance anion-exchange chromatography with pulsed amperometric detection (HPAEC-PAD) can determine the monosaccharide composition and linkage patterns. Matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) mass spectrometry provides information about polymer length distribution and potential modifications. Size exclusion chromatography multi-angle light scattering (SEC-MALS) can determine absolute molecular weight and polydispersity of the mannan products.

Advanced NMR spectroscopy methods, including 1H and 13C NMR, offer detailed structural information about the synthesized mannans, revealing anomeric configurations, linkage types, and branching patterns. Enzymatic fingerprinting using specific glycosidases followed by mass spectrometric analysis of the fragments provides complementary structural details. For visualizing the products, fluorophore-assisted carbohydrate electrophoresis (FACE) or direct staining with carbohydrate-binding modules coupled to fluorescent reporters can be employed. These multiple analytical approaches, when combined, provide comprehensive characterization of both CSLA3 enzymatic properties and the structural features of its mannan products.

How does CSLA3 contribute to cell wall architectural diversity in rice?

CSLA3 plays a nuanced role in generating cell wall architectural diversity through its production of mannans with specific structural features. These mannans integrate into the cell wall matrix, creating distinct interaction networks with cellulose microfibrils and other matrix polysaccharides. The spatial and temporal regulation of CSLA3 expression creates tissue-specific variations in mannan content and structure, contributing to the mechanical and functional specialization of different cell types in rice.

Comparative analyses of cell walls from different rice tissues show correlation between CSLA3 expression patterns and mannan distribution. In tissues with high CSLA3 activity, mannans may constitute a larger proportion of the hemicellulosic fraction, potentially affecting wall porosity, hydration properties, and mechanical resilience. The fine structure of CSLA3-produced mannans, including chain length, degree of substitution, and branching patterns, further contributes to architectural diversity by modulating interactions with other wall components.

Functional studies using CRISPR/Cas9-generated CSLA3 mutants have demonstrated altered cell expansion patterns and modified mechanical properties in specific tissues . These phenotypes can be characterized through comprehensive cell wall analysis techniques, including monosaccharide composition determination, linkage analysis, and immunolabeling with mannan-specific antibodies. Advanced imaging approaches such as atomic force microscopy and electron tomography provide nanoscale visualization of wall architecture in wild-type versus CSLA3-modified plants, revealing how mannans contribute to the three-dimensional organization of cell wall components. Integration of these structural data with functional genomics and mechanical testing provides a comprehensive understanding of CSLA3's role in generating architectural diversity that supports specialized cellular functions in different rice tissues.

What regulatory mechanisms control CSLA3 expression during development and stress?

CSLA3 expression is regulated through complex, multi-layered mechanisms that integrate developmental programs and environmental signals. At the transcriptional level, the CSLA3 promoter contains cis-regulatory elements that respond to developmental transcription factors, hormones, and stress-related signaling pathways. Developmental regulation typically involves tissue-specific transcription factors that coordinate CSLA3 expression with other cell wall biosynthetic genes during processes like cell expansion, secondary wall formation, and reproductive development.

Hormone-responsive elements in the CSLA3 promoter allow modulation by phytohormones including auxin, brassinosteroids, and gibberellins, which are key regulators of plant growth and cell wall modification. Under stress conditions, signaling cascades activated by drought, salinity, pathogens, or mechanical stimuli can alter CSLA3 expression patterns, potentially contributing to stress-adaptive cell wall remodeling. The αAmy3 promoter system presents a model for sugar-responsive gene regulation, suggesting that CSLA3 might similarly respond to metabolic cues through mechanisms involving sugar sensors and signaling components .

Post-transcriptional regulation through mRNA stability, alternative splicing, or microRNA-mediated repression adds another layer of control. At the protein level, CSLA3 activity may be regulated through post-translational modifications, protein-protein interactions, or feedback inhibition by products or metabolites. Systematic analysis of these regulatory mechanisms requires integrated approaches combining promoter dissection, chromatin immunoprecipitation, protein interaction studies, and metabolic profiling. Elucidating these regulatory networks provides insights into how CSLA3-mediated mannan synthesis is coordinated with broader cellular processes and adaptive responses in rice.

How can structure-function analyses advance our understanding of CSLA3 catalytic mechanisms?

Structure-function analyses of CSLA3 provide critical insights into the molecular mechanisms underlying mannan synthesis and offer pathways for enzyme engineering. Systematic mutagenesis targeting conserved motifs and predicted catalytic residues can identify amino acids essential for substrate binding, catalysis, and product specificity. The DXD motifs and surrounding residues are particularly important targets, as they coordinate divalent cations and position the sugar donor for nucleophilic attack.

Chimeric enzyme construction, where domains from CSLA3 are exchanged with those from related glycosyltransferases, can identify regions responsible for specific catalytic properties or substrate preferences. For example, domain swapping between CSLA3 and other CSLA family members with different donor or acceptor specificities can reveal regions that determine whether the enzyme produces pure mannans versus glucomannans or influences chain length. These chimeric enzymes can be expressed using the CRISPR/Cas9 knock-in approach described for rice cells, enabling analysis of their activities in a near-native context .

Advanced structural biology techniques, including cryo-electron microscopy and X-ray crystallography of CSLA3 in complex with substrates or substrate analogs, provide detailed insights into the catalytic mechanism. While membrane proteins like CSLA3 present challenges for crystallization, recent advances in membrane protein structural biology make this approach increasingly feasible. Computational approaches including molecular dynamics simulations can model substrate binding, conformational changes during catalysis, and the effects of mutations on enzyme function. These simulations, validated by experimental data from enzyme kinetics and product analysis, provide a comprehensive understanding of the structure-function relationships in CSLA3.

What are the implications of CSLA3 research for biotechnological applications?

Research on CSLA3 has significant implications for multiple biotechnological applications, particularly in biomass engineering, biopharmaceutical production, and material science. Understanding the molecular mechanisms of CSLA3-mediated mannan synthesis enables rational modification of cell wall polysaccharide composition in rice and other crops. Such modifications can enhance traits like digestibility for animal feed, recalcitrance reduction for biofuel production, or fiber quality for material applications.

The established rice-based expression system utilizing the αAmy3 promoter provides a platform for producing not only wild-type CSLA3 but also engineered variants with altered catalytic properties . Similar approaches have demonstrated high-yield production of recombinant proteins, with expression levels reaching 1.03% of total soluble protein in optimized systems . This platform could be adapted for producing modified mannans with specific structures for pharmaceutical applications, such as immunomodulatory oligosaccharides or nanocarriers for drug delivery.

The CRISPR/Cas9 knock-in methodology developed for recombinant protein expression in rice cells, with transformation efficiencies around 13.5%, offers a powerful approach for rice cell wall engineering through targeted modification of CSLA3 and related enzymes . This technology enables precise genome editing to alter mannan content or structure in specific tissues or developmental stages, potentially improving agronomic traits without compromising plant fitness. Furthermore, insights from CSLA3 research contribute to our fundamental understanding of plant cell wall biosynthesis, with broader implications for sustainable agriculture, renewable materials, and bioenergy production in the context of climate change mitigation and adaptation.

How can researchers address challenges in recombinant CSLA3 functional expression?

Functional expression of recombinant CSLA3 presents several challenges that require systematic troubleshooting approaches. Protein misfolding and aggregation, common issues with membrane proteins, can be addressed through expression optimization. When working with rice-based expression systems, lowering the cultivation temperature to 20-22°C during induction can promote proper folding. Addition of chemical chaperones like glycerol (5-10%) or specific lipids to the culture medium may further enhance correct folding and membrane insertion.

For issues with low expression levels, optimizing the promoter system is crucial. The endogenous αAmy3 promoter offers sugar-responsive expression that can be fine-tuned by adjusting media composition . Experimental evidence indicates that sugar starvation strongly upregulates this promoter, potentially increasing recombinant protein yields . Codon optimization specifically for rice expression can improve translation efficiency, particularly for heterologous proteins. When using CRISPR/Cas9-mediated knock-in approaches, careful design of homology arms and selection of appropriate integration sites can increase transformation efficiency, with reported success rates around 13.5% in rice calli .

For protein activity issues, optimizing extraction and purification conditions is essential. Buffer systems containing appropriate detergents (such as n-dodecyl-β-D-maltoside or CHAPS) at concentrations above their critical micelle concentration help maintain CSLA3 in a soluble, active form. Including stabilizing agents such as glycerol (10-20%), reducing agents, and appropriate cofactors (Mg²⁺ or Mn²⁺) in all buffers helps preserve enzymatic activity throughout purification. Activity assays should be performed at each purification step to monitor protein functionality and optimize conditions accordingly.

How can contradictory results in CSLA3 functional studies be reconciled?

Contradictory results in CSLA3 functional studies often arise from variations in experimental systems, genetic backgrounds, or environmental conditions that require careful reconciliation. A systematic approach begins with standardizing experimental protocols across research groups, establishing consensus methods for enzyme activity assays, expression analysis, and phenotyping procedures. Detailed documentation of experimental conditions, including media composition, growth parameters, and exact sampling timepoints, facilitates identification of sources of variation.

When contradictions arise from studies using different genetic backgrounds, creating isogenic lines through backcrossing or using CRISPR/Cas9 to introduce identical modifications across backgrounds allows for direct comparison . Multi-laboratory validation studies using identical genetic materials and protocols can identify sources of variation stemming from laboratory-specific factors. For seemingly contradictory phenotypes observed in different mutant alleles, conducting allelic series analysis with varying levels of CSLA3 activity can reveal threshold effects or gene dosage relationships.

For biochemical studies with conflicting results, differences in enzyme preparation methods often contribute to discrepancies. Standardizing protein expression systems, purification protocols, and activity assay conditions can resolve such contradictions. When different activity assay methods yield disparate results, parallel analysis using multiple independent techniques provides a more robust assessment. Additionally, environmental factors such as growth conditions of source materials can significantly impact CSLA3 activity and should be carefully controlled and reported. Meta-analysis approaches that systematically integrate data from multiple studies while accounting for methodological differences can help identify consistent patterns amid apparent contradictions in the literature.

What statistical methods are most appropriate for analyzing CSLA3 enzymatic activity data?

Robust statistical analysis of CSLA3 enzymatic activity data requires appropriate methods tailored to the specific experimental design and data characteristics. For basic kinetic parameters such as Km and Vmax, non-linear regression using the Michaelis-Menten equation provides more accurate parameter estimates than linearization methods. Statistical software packages like GraphPad Prism or R (with specialized packages such as 'drc') facilitate these analyses and provide confidence intervals for the estimated parameters.

When comparing kinetic parameters across different CSLA3 variants or experimental conditions, analysis of variance (ANOVA) followed by appropriate post-hoc tests (e.g., Tukey's HSD for multiple comparisons) should be employed. These analyses require adequate technical replicates (minimum of 3-5) and independent biological replicates to account for sources of variation. For experiments with multiple factors affecting CSLA3 activity (e.g., pH, temperature, substrate concentration), factorial design approaches combined with response surface methodology optimize experimental efficiency while enabling detection of interaction effects.

For time-course experiments measuring CSLA3 activity under different conditions, repeated measures ANOVA or mixed-effects models better account for the correlated nature of the measurements. When analyzing complex kinetic mechanisms (such as bi-substrate reactions, product inhibition, or cooperativity), model selection approaches using information criteria (AIC, BIC) determine the most appropriate model without overfitting. All kinetic data analysis should include thorough residual analysis to verify model assumptions and outlier detection methods to identify potential experimental artifacts. Power analysis during experimental design ensures sufficient sample sizes to detect biologically meaningful differences in CSLA3 activity parameters.

How can researchers effectively analyze the impact of CSLA3 modifications on cell wall architecture?

Comprehensive analysis of CSLA3 modifications on cell wall architecture requires multi-scale approaches integrating molecular, chemical, and physical characterization methods. At the chemical level, detailed analysis of cell wall composition should include monosaccharide composition determination through acid hydrolysis followed by HPAEC-PAD or GC-MS analysis. Linkage analysis using methylation followed by GC-MS provides information about glycosidic bonds and branching patterns. These methods can quantify specific changes in mannan content and structure resulting from CSLA3 modifications.

Immunolabeling techniques using mannan-specific monoclonal antibodies, such as LM21 and LM22, enable spatial visualization of mannans in cell walls through fluorescence or electron microscopy. Combining these approaches with fluorescently tagged CSLA3 localization studies provides insights into the relationship between enzyme distribution and resultant mannan deposition patterns. For physical properties, atomic force microscopy can measure nanomechanical properties of cell walls in wild-type versus CSLA3-modified plants, while tensile testing of tissue strips provides macro-scale mechanical data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.