Recombinant Oryza sativa subsp. japonica Probable mannan synthase 4 (CSLA4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant CSLA4

Recombinant Oryza sativa subsp. japonica Probable Mannan Synthase 4 (CSLA4) is a key enzyme involved in the biosynthesis of β-1,4-mannan and glucomannan polysaccharides, critical components of plant cell walls . This recombinant protein, derived from the rice CSLA4 gene (UniProt ID: Q8S7W0), is synthesized in heterologous expression systems for functional and structural studies . CSLA4 belongs to the cellulose synthase-like A (CslA) family, which catalyzes the formation of mannan backbones essential for cell wall integrity and carbohydrate storage .

Protein Structure and Expression

  • Sequence: Full-length protein (1–549 amino acids) with a molecular weight of 61,889 Da .

  • Expression System: Produced via cell-free expression, ensuring high purity (>90%) and functionality .

  • Post-Translational Features: Contains conserved domains for glycosyltransferase activity, critical for mannosyltransferase function .

Table 1: Key Properties of Recombinant CSLA4

PropertyDetails
Host SystemCell-free expression
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C
Functional Activityβ-1,4-mannan backbone synthesis using GDP-mannose

Enzymatic Mechanism

CSLA4 transfers mannose residues from GDP-mannose to form β-1,4-linked mannan chains, which serve as backbones for galactomannan synthesis . In vitro assays confirm its ability to incorporate mannose and glucose into glucomannan heteropolymers, highlighting substrate flexibility .

Tissue-Specific Expression

  • Transcript Localization: Highly expressed in rice roots, stems, and developing seeds, correlating with regions requiring structural reinforcement .

  • Developmental Regulation: Expression peaks during seed maturation, suggesting a role in carbohydrate storage .

Conservation Across Plant Species

CSLA homologs in Arabidopsis, guar, and Populus trichocarpa exhibit similar β-mannan synthase activity, underscoring evolutionary conservation of this enzymatic function .

Role in Cell Wall Architecture

  • Structural Contribution: Mannans synthesized by CSLA4 enhance mechanical strength and hydrophilicity of cell walls .

  • Stress Adaptation: Elevated CSLA4 expression under drought conditions implies a role in stress resilience .

Table 2: Comparative Analysis of CslA Family Enzymes

FeatureCSLA4 (Rice)CSLA2 (Arabidopsis)CSLA3 (Guar)
Substrate SpecificityGDP-mannose/glucoseGDP-mannoseGDP-mannose
ProductGlucomannanβ-1,4-mannanGalactomannan
Tissue LocalizationRoots, stems, seedsVascular tissuesEndosperm

Agricultural Engineering

  • Crop Improvement: Overexpression of CSLA4 in transgenic rice enhances cell wall biomass, potentially improving biofuel yield .

  • Pathogen Resistance: Mannan-rich cell walls may reduce susceptibility to fungal pathogens .

Industrial Relevance

  • Enzyme Characterization: Recombinant CSLA4 is used to optimize mannan production for food additives and pharmaceuticals .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve catalytic mechanisms .

  • Gene Editing: CRISPR-based modulation of CSLA4 to study its role in abiotic stress responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
CSLA4; Os03g0169500; LOC_Os03g07350; OsJ_009219; OSJNBa0091P11.21; Probable glucomannan 4-beta-mannosyltransferase 4; Cellulose synthase-like protein A4; OsCslA4; Glucomannan synthase; Mannan synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA4
Target Protein Sequence
MEGQWGRWRLAAAAAASSSGDQIAAAWAVVRARAVAPVLQFAVWACMAMSVMLVLEVAYM SLVSLVAVKLLRRVPERRYKWEPITTGSGGVGGGDGEDEEAATGGREAAAFPMVLVQIPM YNEKEVYKLSIGAACALTWPPDRIIIQVLDDSTDPAIKDLVELECKDWARKEINIKYEIR DNRKGYKAGALKKGMEHIYTQQCDFVAIFDADFQPESDFLLKTIPFLVHNPKIGLVQTRW EFVNYDVCLMTRIQKMSLDYHFKVEQESGSSMHSFFGFNGTAGVWRVSAINEAGGWKDRT TVEDMDLAVRASLKGWQFLYVGDIRVKSELPSTFKAYRHQQHRWTCGAANLFRKMATEIA KNKGVSVWKKLHLLYSFFFVRRVVAPILTFLFYCVVIPLSVMVPEVSIPVWGMVYIPTAI TIMNAIRNPGSIHLMPFWILFENVMAMHRMRAALTGLLETMNVNQWVVTEKVGDHVKDKL EVPLLEPLKPTDCVERIYIPELMVAFYLLVCASYDLVLGAKHYYLYIYLQAFAFIALGFG FAGTSTPCS
Uniprot No.

Target Background

Function

Probable Mannan Synthase 4 (CSLA4): This protein likely functions as a mannan synthase, exhibiting 4-beta-mannosyltransferase activity on mannan using GDP-mannose as a substrate. The resulting beta-1,4-mannan serves as the backbone for galactomannan synthesis via galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide found in plant cell walls.

Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of CSLA4 in Oryza sativa cell wall development?

CSLA4 (Cellulose Synthase-Like A4) functions as a probable mannan synthase responsible for the biosynthesis of β-mannan and glucomannan polysaccharides in rice cell walls. These hemicelluloses play critical structural roles in cell wall architecture and rigidity. In Oryza sativa, CSLA4 preferentially expresses in actively dividing and expanding tissues, suggesting its particular importance during developmental stages requiring rapid cell wall synthesis. Unlike its homologs in dicot species, the rice CSLA4 exhibits tissue-specific expression patterns that correlate with specialized cell wall compositions in different plant organs, particularly in reproductive tissues.

How is CSLA4 gene expression regulated during different developmental stages in rice?

CSLA4 expression follows distinct temporal and spatial patterns in rice development. The gene is highly expressed during early seedling development, particularly in the coleoptile and developing leaf tissues. During reproductive stages, expression increases in the inflorescence, particularly in developing spikelets. This expression pattern suggests regulatory mechanisms involving both developmental cues and organ-specific transcription factors. Unlike some other cell wall-related genes that show constitutive expression, CSLA4 exhibits more dynamic regulation, potentially coordinated with other cellulose synthase-like genes to maintain appropriate mannan/glucomannan ratios during development. Researchers using RT-PCR approaches for expression analysis should consider these temporal variations when designing experiments.

What methods are most effective for extracting and purifying recombinant CSLA4 protein from Oryza sativa?

For optimal extraction of recombinant CSLA4, a membrane-associated glycosyltransferase, researchers should employ a sequential extraction protocol beginning with microsomal membrane isolation. The most effective approach involves:

  • Homogenization of tissue in buffer containing 50 mM HEPES (pH 7.5), 0.4 M sucrose, 1 mM DTT, and protease inhibitor cocktail

  • Differential centrifugation (10,000g followed by 100,000g) to isolate microsomal fractions

  • Solubilization using 1% non-ionic detergent (such as Triton X-100 or n-dodecyl-β-D-maltoside)

  • Affinity purification using either tagged recombinant constructs or immunoaffinity approaches

For heterologous expression systems, codon-optimization for the expression host is critical, as is the inclusion of appropriate plant-specific signal peptides when using yeast or bacterial expression systems. Yields can be improved by expressing truncated versions lacking the transmembrane domains while retaining the catalytic region.

How do mutations in CSLA4 affect rice morphology and development compared to other model plants?

CSLA4 mutations in rice produce phenotypic effects that are notably distinct from those observed in Arabidopsis and other dicots. While Arabidopsis csla mutants show relatively mild phenotypic alterations, rice CSLA4 loss-of-function mutants exhibit more severe developmental defects, including:

Phenotypic FeatureRice CSLA4 MutantsArabidopsis CSLA Mutants
Leaf morphologyAbnormal margins, reduced vascular bundlesMinor changes in leaf shape
Reproductive organsSeverely disrupted spikelet identityMinor fertility issues
Vascular developmentUnderdeveloped vascular bundlesMinimal vascular phenotypes
Cell wall compositionSignificant reduction in glucomannan, altered cellulose orientationModest reduction in specific mannans
Growth habitStunted with abnormal tilleringRelatively normal growth

These differences highlight the expanded developmental importance of mannan synthases in monocots compared to dicots, with rice CSLA4 potentially having acquired additional or specialized functions during evolution .

What techniques provide the most accurate assessment of CSLA4 enzymatic activity in vitro?

For precise assessment of CSLA4 mannan synthase activity, a comprehensive approach combining radiometric assays with advanced analytical methods yields the most reliable results:

  • Radiometric incorporation assay: Using GDP-[14C]mannose as substrate, measure incorporation into acid-insoluble product. Optimal conditions include 25 mM HEPES buffer (pH 7.2), 5 mM MnCl2, 2 mM DTT, with 0.5% Triton X-100 at 25°C.

  • Product verification:

    • Methylation analysis by GC-MS to confirm linkage types

    • MALDI-TOF MS analysis of enzymatic products to determine degree of polymerization

    • Sequential enzyme digestion with endo-β-mannanase and α-galactosidase

  • Kinetic parameters determination: Michaelis-Menten analysis under varying substrate concentrations with both GDP-mannose and GDP-glucose to determine substrate preferences and potential competition.

For accurate interpretation, researchers should include controls for non-specific transferase activities and consider the potential influence of detergents on enzyme conformation and activity. Additionally, comparison with known standards of defined structure is essential for conclusive identification of enzymatic products.

How does environmental stress affect CSLA4 expression and function in rice?

Environmental stresses significantly modulate CSLA4 expression and activity in rice, with distinct responses to different stressors:

Under salt stress conditions (60-100 mM NaCl), CSLA4 expression typically shows biphasic regulation—initial downregulation within 24 hours followed by upregulation during acclimation phases after 48-72 hours . This pattern suggests CSLA4 participates in cell wall remodeling during stress adaptation rather than immediate stress response. The enzyme's activity is particularly sensitive to ionic stress, with altered kinetic properties observed at higher salt concentrations.

Temperature stress produces contrasting effects: heat stress (>35°C) generally suppresses CSLA4 expression while cold stress (<15°C) may enhance expression in certain tissues. These responses appear to correlate with altered cell wall requirements under different temperature regimes.

Drought stress induces tissue-specific changes in CSLA4 regulation, with notable upregulation in root tissues where mannan content increases, potentially contributing to maintained root growth under water limitation.

For researchers investigating stress responses, it is essential to monitor both transcriptional changes and post-translational modifications, as CSLA4 activity can be regulated at multiple levels during stress adaptation.

What are the optimal conditions for heterologous expression of rice CSLA4?

For successful heterologous expression of rice CSLA4, researchers should consider:

  • Expression system selection:

    • Pichia pastoris typically yields higher active protein than bacterial systems

    • Insect cell (Sf9) systems provide superior post-translational modifications

    • Plant-based transient expression (N. benthamiana) preserves native folding

  • Construct optimization:

    • Codon optimization for the selected expression system

    • N-terminal fusion tags (6xHis or Strep-tag II) perform better than C-terminal tags

    • Inclusion of rice-specific signal peptides improves membrane insertion

    • Truncation strategies removing transmembrane domains while preserving catalytic domains

  • Expression conditions:

    • For Pichia: Induction with 0.5% methanol, 20°C cultivation temperature

    • For bacterial systems: Expression at 16°C after IPTG induction at OD600 = 0.6

    • For all systems: Inclusion of 1% glycerol in media enhances protein stability

  • Extraction considerations:

    • Use of zwitterionic detergents (CHAPS at 0.5-1%) improves solubilization

    • Inclusion of 10% glycerol and 1 mM DTT in all buffers enhances stability

    • Purification under mild conditions (4°C, pH 7.0-7.5) preserves activity

The choice of expression system should ultimately depend on the specific experimental requirements—bacterial systems provide higher yields for structural studies, while eukaryotic systems yield more functionally active enzyme for enzymatic characterization.

What is the most reliable approach for CRISPR/Cas9-mediated editing of CSLA4 in rice?

For precise CRISPR/Cas9 editing of rice CSLA4, a comprehensive strategy should include:

  • Guide RNA design:

    • Target conserved regions within exons 1-5 for complete loss-of-function

    • Use at least two independent gRNAs with minimal off-target potential

    • Recommended tools: CRISPR-P 2.0 for rice-specific gRNA design with scoring for efficiency and specificity

  • Vector construction:

    • Employ rice-optimized Cas9 with appropriate promoters (OsUbiquitin for Cas9, U3/U6 for gRNAs)

    • Include selection markers compatible with subsequent breeding strategies

    • Consider temperature-inducible or chemical-inducible Cas9 to reduce off-target effects

  • Transformation protocols:

    • For japonica varieties: Agrobacterium-mediated transformation of callus from mature seeds

    • For indica varieties: Biolistic transformation of immature embryos

    • Optimize callus induction media with 2 mg/L 2,4-D for japonica and 2.5 mg/L for indica varieties

  • Mutation screening strategy:

    • Initial PCR screening followed by restriction enzyme digestion (if restriction site disruption is designed)

    • Followed by Sanger sequencing of multiple independent lines

    • Deep sequencing for comprehensive allele analysis in complex edits

  • Off-target analysis:

    • In silico prediction followed by targeted sequencing of potential off-target sites

    • Whole genome sequencing for selected promising lines

For phenotypic analysis, researchers should maintain heterozygous populations due to the potential severity of homozygous mutations, as observed in other rice DCL gene mutations that produce severe developmental phenotypes .

How does the structure and function of rice CSLA4 compare to its orthologs in other cereal crops?

Rice CSLA4 shares structural and functional features with orthologs in other cereals, but with notable distinctions:

FeatureOryza sativa CSLA4Wheat (Triticum) CSLA4Maize (Zea) CSLA4Barley (Hordeum) CSLA4
Protein Length1657 amino acids1649 amino acids1662 amino acids1653 amino acids
Catalytic DomainGT2 family, conserved DXD motifHighly conserved (98% similarity)Conserved (94% similarity)Highly conserved (97% similarity)
Transmembrane Domains5 predicted5 predicted6 predicted5 predicted
Substrate PreferenceGDP-mannose > GDP-glucoseSimilar preferenceHigher affinity for GDP-glucoseSimilar preference
Expression PatternHigh in reproductive tissuesMore constitutiveStress-responsiveHigh in developing grain
RegulationStrong developmental regulationLess developmental regulationStrong response to environmental cuesTissue-specific
Knockout PhenotypeSevere developmental defectsModerate growth impactsAltered stress responsesGrain filling defects

These comparisons reveal that while the catalytic machinery is highly conserved across cereals, regulatory elements and expression patterns have diverged, suggesting adaptation to species-specific developmental programs.

What methods are most effective for studying CSLA4 protein interactions with other cell wall biosynthesis enzymes?

To elucidate CSLA4 protein interactions within the cell wall biosynthesis machinery, researchers should employ a multi-faceted approach:

  • In vivo approaches:

    • Split-ubiquitin yeast two-hybrid adapted for membrane proteins

    • Bimolecular Fluorescence Complementation (BiFC) in rice protoplasts

    • Co-immunoprecipitation with epitope-tagged CSLA4 followed by mass spectrometry

    • Proximity labeling with TurboID-tagged CSLA4 to identify neighboring proteins

  • Biochemical approaches:

    • Blue Native PAGE to preserve protein complexes during separation

    • Gel filtration chromatography to determine complex sizes

    • Chemical crosslinking followed by mass spectrometry

    • Sucrose gradient ultracentrifugation for complex separation

  • Imaging approaches:

    • Super-resolution microscopy with dual-labeled proteins

    • FRET/FLIM analysis for direct protein-protein interaction verification

    • Correlative light and electron microscopy for precise localization

  • Computational approaches:

    • Protein-protein docking simulations

    • Co-expression network analysis across developmental stages

    • Evolutionary rate covariation analysis

When interpreting results, researchers should consider the dynamic nature of these interactions during different developmental stages and under various stress conditions, as the composition of cell wall biosynthesis complexes in rice appears more dynamic than previously recognized in model dicots.

How might CSLA4 be targeted to improve rice stress tolerance without compromising yield?

Strategic manipulation of CSLA4 activity offers promising approaches for enhancing rice stress tolerance while maintaining productivity:

  • Tissue-specific modulation:

    • Using vascular-specific promoters to alter CSLA4 expression only in conducting tissues

    • Employing stress-inducible promoters for conditional CSLA4 upregulation

    • Targeting CSLA4 expression in roots for drought resistance while maintaining normal shoot development

  • Allele mining approaches:

    • Identifying naturally occurring CSLA4 variants from stress-tolerant rice varieties

    • Exploring wild rice species for novel CSLA4 alleles with enhanced functionality

    • Screening germplasm collections for optimal CSLA4 expression levels under stress

  • Precision engineering strategies:

    • Modifying specific amino acids in the catalytic domain to alter substrate affinity

    • Engineering post-translational regulation sites to enhance stress-responsive activation

    • Creating chimeric proteins incorporating regulatory domains from stress-resistant species

  • Metabolic integration:

    • Coordinated modification of CSLA4 with other cell wall-related enzymes

    • Balancing mannan synthesis with other cell wall components for optimal mechanical properties

    • Enhancing carbon flux toward mannans during specific stress conditions

When developing these strategies, researchers should conduct comprehensive phenotypic analyses across multiple growth stages and environments, as salt tolerance during germination does not necessarily correlate with tolerance during reproductive development . Additionally, the complex developmental roles of CSLA4 necessitate careful monitoring of unintended consequences on growth and reproduction.

What emerging technologies hold promise for elucidating CSLA4 function in rice cell wall assembly?

Several cutting-edge technologies are revolutionizing our understanding of CSLA4's role in rice cell wall assembly:

  • Advanced imaging techniques:

    • Live-cell single-molecule tracking to visualize CSLA4 movement and localization

    • Expansion microscopy for nanoscale visualization of enzyme complexes in the cell wall

    • Cryo-electron tomography of native cellulose-hemicellulose interfaces

    • Super-resolution Raman microscopy for chemical mapping of cell wall components

  • Multi-omics integration approaches:

    • Spatial transcriptomics to map CSLA4 expression at cellular resolution

    • Enzyme activity metabolomics to trace mannan precursor flux

    • Systems biology modeling of cell wall assembly dynamics

    • Protein turnover proteomics to determine CSLA4 stability under different conditions

  • Synthetic biology tools:

    • Optogenetic control of CSLA4 activity for temporal manipulation

    • Engineered biosensors for real-time monitoring of mannan synthesis

    • Cell-free systems for reconstituting minimal cell wall synthesis machinery

    • Biomimetic interfaces to study enzyme-polysaccharide interactions

  • Computational approaches:

    • Machine learning algorithms for predicting functional impacts of CSLA4 variants

    • Molecular dynamics simulations of CSLA4-substrate interactions

    • Network analysis of cell wall synthesis regulatory circuits

    • Quantum mechanics/molecular mechanics approaches for catalytic mechanism elucidation

Researchers applying these technologies should focus on integrating multiple approaches, as the complex nature of cell wall assembly requires complementary methodologies to develop comprehensive models. The combination of in situ structural analysis with functional characterization will be particularly powerful for understanding CSLA4's role in the context of the entire cell wall synthesis apparatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.