Recombinant Oryza sativa subsp. japonica Probable mannan synthase 5 (CSLA5)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CSLA5; Os03g0377700; LOC_Os03g26044; OsJ_11041; OSJNBb0048D20.18; Probable glucomannan 4-beta-mannosyltransferase 5; Cellulose synthase-like protein A5; OsCslA5; Glucomannan synthase; Mannan synthase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-574
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA5
Target Protein Sequence
MEAGEAAGAVLFLLAAAVSLLAAVSTGALDFTYLVTVVGEGSSTSPGSGGGAWWREAWVG
ARSRAVAPALQVGVWACMVMSVMLVVEATYNSAVSVAARLVGWRPERWFKWEPLGGGAGA
GDEEKGEAAAAAYPMVMVQIPMYNELEVYKLSIGAVCGLKWPKERLIIQVLDDSTDAFIK
NLVELECEDWASKGLNIKYATRSGRKGFKAGALKKGMEWDYAKQCEYVAIFDADFQPEPD
FLLRTVPFLMHNQNVALVQARWVFVNDRVSLLTRIQKTFLDYHFKAEQEAGSATFAFFSF
NGTAGVWRTEAINDAGGWKDRTTVEDMDLAVRATLKGWKFIYLGDLRVKSELPSTYKAYC
RQQFRWSCGGANLFRKMIWDVLVAKKVSSLKKIYILYSFFLVRRVVAPAVAFILYNVIIP
VSVMIPELFLPIWGVAYIPTALLIVTAIRNPENLHTVPLWILFESVMSMHRLRAAVAGLL
QLQEFNQWIVTKKVGNNAFDENNETPLLQKSRKRLINRVNLPEIGLSVFLIFCASYNLVF
HGKNSFYINLYLQGLAFFLLGLNCVGTLPDHCCF
Uniprot No.
Target Background
Function
Probable mannan synthase with 4-β-mannosyltransferase activity on mannan, utilizing GDP-mannose as a substrate. The resulting β-1,4-mannan serves as the backbone for galactomannan synthesis via galactomannan galactosyltransferase. Galactomannan is a non-cellulosic polysaccharide component of plant cell walls.
Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
