Recombinant Oryza sativa subsp. japonica Probable mannan synthase 6 (CSLA6)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

CSLA6 is a recombinant glycosyltransferase enzyme derived from Oryza sativa subsp. japonica (rice). It belongs to the cellulose synthase-like A (CSLA) family, which synthesizes β-1,4-linked non-cellulosic polysaccharides such as mannans and glucomannans .

  • UniProt ID: Q6Z2T9

  • Gene Name: CSLA6

  • Synonyms: Probable glucomannan 4-beta-mannosyltransferase 6, OsCslA6 .

  • Protein Length: Full-length (1–574 amino acids) .

Functional Role and Mechanism

CSLA6 catalyzes the polymerization of β-1,4-linked mannose (Man) or glucose (Glc) residues to form mannans or glucomannans, respectively. This activity is critical for plant cell wall biosynthesis, particularly in hemicellulose production .

Key Functional Insights from CSLA Family Research

  1. Substrate Specificity:

    • CSLA enzymes can utilize GDP-mannose to synthesize β-mannans or combine GDP-mannose/GDP-glucose to produce glucomannans .

    • For example, Arabidopsis thaliana CSLA9 produces β-mannan, β-glucan, or glucomannan heteropolymers depending on substrate availability .

  2. Cofactor Dependency:

    • MSR (MANNAN SYNTHESIS RELATED) proteins modulate CSLA activity. In Pichia pastoris, MSR cofactors are required for glucomannan synthesis by certain CSLA isoforms (e.g., Arabidopsis CSLA2) .

    • MSR proteins may stabilize CSLA enzymes, enhance substrate affinity, or direct glycosylation patterns .

  3. Polymer Size and Structure:

    • CSLA-synthesized polysaccharides can exceed 270 kDa in size and are linear, unbranched structures .

    • Enzymatic digestion with β-mannanase or cellulase confirms the presence of β-1,4 linkages .

Heterologous Expression Platforms

CSLA6 is typically expressed in E. coli for structural and enzymatic studies. Comparative studies in yeast or insect cells (e.g., Pichia pastoris, Drosophila S2 cells) reveal insights into:

  • Enzyme Activity: CSLA6’s ability to synthesize mannans or glucomannans.

  • Cofactor Interactions: Synergy with MSR-like proteins to produce tailored polysaccharides .

Analytical Techniques

MethodPurpose
SDS-PAGEPurity assessment (≥90%)
Size-Exclusion ChromatographyPolymer molecular weight profiling (e.g., 5–270 kDa)
1H-NMR SpectroscopyStructural characterization (e.g., Glc:Man ratios in glucomannans)

Comparative Analysis with Other CSLA Isoforms

FeatureCSLA6CSLA2 (Arabidopsis)CSLA9 (Arabidopsis)
Primary ProductMannan/glucomannan Mannan Mannan, glucan, glucomannan
Cofactor DependencyMSR-like proteins (hypothesized) Requires MSR1 for glucomannan Independent of cofactors
Substrate FlexibilityGDP-mannose (predicted) GDP-mannose only GDP-mannose/GDP-glucose

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
CSLA6; Os02g0744600/Os02g0744650; Os02g0744500; LOC_Os02g51060; OJ1118_G04.6; OJ1734_E02.33; Probable glucomannan 4-beta-mannosyltransferase 6; Cellulose synthase-like protein A6; OsCslA6; Glucomannan synthase; Mannan synthase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-574
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA6
Target Protein Sequence
MQGSSTSILHFVPSDPTSTSVLDFLSPTPRGTSPVHDRRLHAGDLALRAGGDRLLVADTV AAVVESLVQAWRQVRMELLVPLLRGAVVACMVMSVIVLAEKVFLGVVSAVVKLLRRRPAR LYRCDPVVVEDDDEAGRASFPMVLVQIPMYNEKEVYQLSIGAACRLTWPADRLIVQVLDD STDAIVKELVRKECERWGKKGINVKYETRKDRAGYKAGNLREGMRRGYVQGCEFVAMLDA DFQPPPDFLLKTVPFLVHNPRLALVQTRWEFVNANDCLLTRMQEMSMDYHFKVEQEAGSS LCNFFGYNGTAGVWRRQVIDESGGWEDRTTAEDMDLALRAGLLGWEFVYVGSIKVKSELP STLKAYRSQQHRWSCGPALLFKKMFWEILAAKKVSFWKKLYMTYDFFIARRIISTFFTFF FFSVLLPMKVFFPEVQIPLWELILIPTAIILLHSVGTPRSIHLIILWFLFENVMALHRLK ATLIGFFEAGRANEWIVTQKLGNIQKLKSIVRVTKNCRFKDRFHCLELFIGGFLLTSACY DYLYRDDIFYIFLLSQSIIYFAIGFEFMGVSVSS
Uniprot No.

Target Background

Function
This protein is a probable mannan synthase that exhibits 4-beta-mannosyltransferase activity on mannan using GDP-mannose. The beta-1,4-mannan product serves as the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharide found in the plant cell wall.
Database Links

STRING: 39947.LOC_Os02g51060.1

UniGene: Os.6170

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is CSLA6 from Oryza sativa subsp. japonica and what is its fundamental role?

CSLA6 (Probable mannan synthase 6) is a protein from rice (Oryza sativa subsp. japonica) that belongs to the CSLA family of glycosyltransferases. It is believed to function as a mannan synthase involved in cell wall polysaccharide biosynthesis. The recombinant form of this protein consists of 574 amino acids (full length) and is often expressed with an N-terminal His-tag in expression systems like E. coli for research purposes .

The protein plays a significant role in plant cell wall development, specifically in the synthesis of mannans, which are hemicellulosic polysaccharides found in plant cell walls. Understanding this protein is crucial for researchers studying plant cell wall biology, plant development, and potential applications in agriculture.

How is recombinant CSLA6 typically produced for research applications?

Recombinant CSLA6 is typically produced using bacterial expression systems, with E. coli being the most common host organism. The process involves:

  • Cloning the CSLA6 gene sequence (encoding amino acids 1-574) into an appropriate expression vector

  • Incorporating a His-tag at the N-terminus for purification purposes

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under controlled conditions

  • Lysing the bacterial cells to release the recombinant protein

  • Purifying the protein using affinity chromatography (typically Ni-NTA resin that binds to the His-tag)

  • Further purification steps as needed (e.g., size exclusion chromatography)

  • Lyophilization to produce a stable powder form

The resulting recombinant protein is typically provided as a lyophilized powder that can be reconstituted in appropriate buffers for various experimental applications.

What are the optimal storage and handling conditions for recombinant CSLA6 protein?

For optimal stability and activity of recombinant CSLA6 protein, researchers should follow these evidence-based practices:

  • Storage conditions: Store the lyophilized powder at -20°C to -80°C upon receipt. After reconstitution, store working aliquots at 4°C for up to one week .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

    • Prepare small aliquots to avoid repeated freeze-thaw cycles

  • Buffer compatibility: The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

  • Stability considerations: Repeated freeze-thaw cycles should be avoided as they can significantly decrease protein activity and integrity .

How does CSLA6 fit into the evolutionary context of plant cell wall synthesis genes?

CSLA6 belongs to a family of genes that has evolved within a complex evolutionary framework in plants. Based on comparative genomic analyses between rice and Arabidopsis thaliana:

  • Evolutionary conservation: The CSLA gene family is part of the conserved functional domains found across plant species, suggesting fundamental roles in plant cellular processes .

  • Duplication patterns: Gene duplication events have shaped the evolution of many plant genes, including those involved in cell wall synthesis. The distribution of gene duplicates shows similarities between rice and Arabidopsis, suggesting common selective pressures .

  • Selective pressure: Natural selection appears to have played a significant role in shaping gene duplication patterns in both rice and Arabidopsis. For genes like CSLA6, duplication may have been either suppressed or favored depending on the functional consequences .

  • Lineage-specific adaptations: While core functions are conserved, rice possesses some lineage-specific genes not found in Arabidopsis, which may account for species-specific cell wall characteristics .

What experimental approaches can be used to investigate the functional role of CSLA6 in mannan synthesis?

To elucidate the functional role of CSLA6 in mannan synthesis, researchers can employ several sophisticated experimental approaches:

  • In vitro enzymatic assays:

    • Prepare purified recombinant CSLA6 protein (His-tagged, full-length 1-574aa)

    • Incubate with appropriate substrates (GDP-mannose, GDP-glucose)

    • Analyze reaction products using techniques such as HPLC, mass spectrometry, or NMR

    • Determine kinetic parameters (Km, Vmax) under varying conditions

  • Genetic manipulation approaches:

    • Generate CSLA6 knockout/knockdown rice plants using CRISPR-Cas9 or RNAi

    • Create overexpression lines with constitutive or inducible promoters

    • Analyze resulting phenotypes and cell wall composition

    • Consider insertional mutant lines, as many protein-coding genes in rice have been disrupted in available mutant collections

  • Cell wall analysis methods:

    • Extract and fractionate cell wall polysaccharides

    • Perform comprehensive microarray polymer profiling (CoMPP)

    • Use specific glycan-directed monoclonal antibodies to detect mannans

    • Employ methylation analysis to determine linkage patterns

  • Localization and interaction studies:

    • Generate fluorescent protein fusions to determine subcellular localization

    • Perform co-immunoprecipitation to identify interacting proteins

    • Use bimolecular fluorescence complementation (BiFC) to confirm protein-protein interactions in vivo

How can structural analysis of CSLA6 inform our understanding of its catalytic mechanism?

Structural analysis of CSLA6 can provide crucial insights into its catalytic mechanism through the following approaches:

  • Protein structure prediction and analysis:

    • Use the full amino acid sequence of CSLA6 (574aa) for homology modeling

    • Identify conserved domains and catalytic residues through sequence alignment with characterized glycosyltransferases

    • Predict substrate binding sites and active site geometry

  • Experimental structure determination:

    • Express and purify recombinant CSLA6 in sufficient quantities for structural studies

    • Attempt protein crystallization for X-ray crystallography

    • Consider cryo-EM as an alternative approach for structure determination

    • Analyze protein dynamics through hydrogen-deuterium exchange mass spectrometry

  • Structure-function relationship studies:

    • Design site-directed mutagenesis experiments targeting predicted catalytic residues

    • Assess effects of mutations on enzyme activity and substrate specificity

    • Correlate structural features with enzymatic parameters

  • Molecular dynamics simulations:

    • Perform computational simulations to study protein flexibility and substrate interactions

    • Model the catalytic cycle and conformational changes during mannan synthesis

    • Predict the effects of different substrates on enzyme structure

What experimental design considerations are critical when studying CSLA6 function in rice?

When designing experiments to study CSLA6 function in rice, several methodological considerations are essential:

  • Appropriate controls and variables:

    • Define clear independent variables (e.g., CSLA6 expression levels) and dependent variables (e.g., mannan content, plant phenotype)

    • Include proper controls (wild-type plants, plants with mutations in other CSLA genes)

    • Account for extraneous variables such as growth conditions, developmental stage, and tissue specificity

  • Sampling strategy:

    • Ensure representative sampling to minimize bias

    • Determine appropriate sample sizes through power analysis

    • Consider biological and technical replicates to account for variation

  • Experimental treatments:

    • Design treatments to specifically target CSLA6 function

    • Consider dose-response relationships if applicable

    • Plan for time-course experiments to capture developmental aspects

  • Data collection and analysis:

    • Develop standardized protocols for consistent data collection

    • Select appropriate statistical methods for data analysis

    • Plan for potential complications in interpretation due to redundant gene functions

How can researchers effectively reconstitute and validate the activity of recombinant CSLA6 protein?

Effective reconstitution and validation of recombinant CSLA6 activity involves several critical steps:

  • Optimal reconstitution protocol:

    • Centrifuge the lyophilized protein briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to 5-50% final concentration

    • Aliquot to avoid repeated freeze-thaw cycles

  • Protein quality assessment:

    • Verify protein purity via SDS-PAGE (should be >90%)

    • Confirm protein identity through Western blot or mass spectrometry

    • Assess protein folding using circular dichroism spectroscopy

    • Check for aggregation using dynamic light scattering

  • Activity validation approaches:

    • Develop a specific enzymatic assay for mannan synthase activity

    • Determine optimal reaction conditions (pH, temperature, cofactors)

    • Measure product formation using appropriate analytical techniques

    • Compare activity with published values for similar enzymes

  • Troubleshooting strategies:

    • If activity is low, consider alternative buffer conditions

    • Test different substrate concentrations to identify potential inhibition

    • Evaluate the impact of potential cofactors or activators

    • Consider removing the His-tag if it might interfere with activity

How can CSLA6 research contribute to our understanding of plant cell wall biology and crop improvement?

Research on CSLA6 has significant implications for plant biology and agriculture:

  • Fundamental plant biology insights:

    • Elucidates mechanisms of cell wall polysaccharide biosynthesis

    • Contributes to understanding evolutionary processes in plant genomes

    • Helps explain functional redundancy and specialization within gene families

    • Provides insights into cell wall development and structure-function relationships

  • Crop improvement applications:

    • Potential targets for modifying cell wall composition to improve biofuel production

    • Opportunities to enhance stress resistance through cell wall modifications

    • Possible strategies to improve digestibility in forage crops

    • Development of rice varieties with enhanced agronomic traits

  • Comparative genomics approaches:

    • Analysis of CSLA genes across rice subspecies and related cereals

    • Identification of natural variation that could be exploited in breeding programs

    • Understanding how selection has shaped gene function during domestication

What analytical techniques are most appropriate for studying the products of CSLA6 enzymatic activity?

To effectively analyze the products of CSLA6 enzymatic activity, researchers should consider these analytical approaches:

  • Carbohydrate analysis methods:

    • HPAEC-PAD (High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection) for sensitive detection of oligosaccharides

    • Size exclusion chromatography to determine polysaccharide molecular weight

    • Linkage analysis using methylation followed by GC-MS

    • NMR spectroscopy for detailed structural characterization

  • Mass spectrometry approaches:

    • MALDI-TOF MS for molecular weight determination

    • LC-MS/MS for detailed structural analysis

    • ESI-MS for analysis of oligosaccharide fragments

    • Isotopic labeling experiments to track incorporation of specific sugars

  • Microscopy and imaging techniques:

    • Immunogold labeling with mannan-specific antibodies for TEM

    • Fluorescence microscopy with labeled carbohydrate-binding modules

    • Atomic force microscopy to visualize polysaccharide structure

    • Super-resolution microscopy for detailed localization studies

  • Biochemical characterization:

    • Enzyme digestion with specific glycosidases

    • Viscometry to assess solution properties

    • Colorimetric assays for quantification

    • Radioactive labeling for high-sensitivity detection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.