Recombinant Oryza sativa subsp. japonica Probable mannan synthase 7 (CSLA7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa subsp. japonica Probable Mannan Synthase 7 (CSLA7)

Recombinant Oryza sativa subsp. japonica Probable Mannan Synthase 7 (CSLA7) is a full-length, heterologously expressed enzyme involved in the biosynthesis of plant cell wall polysaccharides. This protein belongs to the cellulose synthase-like A (CSLA) family, which catalyzes the formation of β-1,4-linked mannan and glucomannan backbones . Produced in E. coli with an N-terminal His tag, it serves as a critical tool for studying plant cell wall dynamics and developmental biology .

Functional Insights

  • Mannan/Glucomannan Synthesis: CSLA7 catalyzes the transfer of mannose from GDP-mannose to form β-1,4-mannan or glucomannan chains, which are structural components of plant cell walls .

  • Embryogenesis: In Arabidopsis, CSLA7 is essential for embryo development, with knockout mutants exhibiting lethal phenotypes . Overexpression disrupts embryogenesis, indicating tight regulation of glucomannan levels .

  • Evolutionary Conservation: CSLA homologs across land plants (e.g., Arabidopsis, loblolly pine, Physcomitrella patens) share mannan synthase activity, suggesting conserved roles in cell wall biology .

Production and Purification

  • Expression System: Optimized for E. coli to ensure high yield and solubility .

  • Activity Assays: Used in enzymatic studies to investigate substrate specificity (GDP-mannose vs. GDP-glucose) and kinetic properties .

Research Applications

  • Cell Wall Studies: Elucidates mannan’s role in cell adhesion, mechanical strength, and carbohydrate storage .

  • Genetic Engineering: Guides efforts to modify crop cell walls for improved biomass conversion or stress resistance .

  • Structural Biology: Facilitates crystallography or cryo-EM studies to resolve catalytic mechanisms .

Comparative Analysis with Related Enzymes

FeatureCSLA7 (Rice)AtCSLA7 (Arabidopsis)CSLD Family (Arabidopsis)
Primary Activityβ-1,4-mannan/glucomannan synthaseEmbryo-specific glucomannan synthaseMannan synthase (requires co-expression)
Expression SystemE. coliInsect cells/Drosophila S2 cellsTobacco microsomes
Mutant PhenotypeNot reportedEmbryo-lethalDelayed developmental transitions

CSLA7 differs from CSLD enzymes, which exhibit lower glucose incorporation and require protein complexes for activity .

Critical Research Findings

  • Enzymatic Redundancy: In Arabidopsis, CSLA2, CSLA3, and CSLA9 compensate for CSLA7 loss in vegetative tissues, but not during embryogenesis .

  • Substrate Flexibility: Recombinant CSLA7 incorporates both mannose and glucose in vitro, producing glucomannan heteropolymers .

  • Regulatory Role: Elevated glucomannan levels impair embryogenesis, suggesting a signaling role beyond structural support .

Challenges and Future Directions

  • Functional Redundancy: CSLA family members’ overlapping roles complicate genetic studies in rice .

  • Structural Insights: The lack of a resolved 3D structure limits mechanistic understanding .

  • Biotechnological Potential: Engineering CSLA7 for tailored cell wall modifications remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during the order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for accurate delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
CSLA7; Os07g0630900; LOC_Os07g43710; P0011H09.139; Probable glucomannan 4-beta-mannosyltransferase 7; Cellulose synthase-like protein A7; OsCslA7; Glucomannan synthase; Mannan synthase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLA7
Target Protein Sequence
MVEAGEIGGAAVFALAAAAALSAASSLGAVDFRRPLAAVGGGGAFEWDGVVPWLIGVLGG GDEAAAGGVSVGVAAWYEVWVRVRGGVIAPTLQVAVWVCMVMSVMLVVEATFNSAVSLGV KAIGWRPEWRFKWEPLAGADEEKGRGEYPMVMVQIPMYNELEVYKLSIGAACELKWPKDK LIVQVLDDSTDPFIKNLVELECESWASKGVNIKYVTRSSRKGFKAGALKKGMECDYTKQC EYIAIFDADFQPEPNFLLRTVPFLMHNPNVALVQARWAFVNDTTSLLTRVQKMFFDYHFK VEQEAGSATFAFFSFNGTAGVWRTTAINEAGGWKDRTTVEDMDLAVRASLNGWKFIYVGD IRVKSELPSTYGAYCRQQFRWACGGANLFRKIAMDVLVAKDISLLKKFYMLYSFFLVRRV VAPMVACVLYNIIVPLSVMIPELFIPIWGVAYIPMALLIITTIRNPRNLHIMPFWILFES VMTVLRMRAALTGLMELSGFNKWTVTKKIGSSVEDTQVPLLPKTRKRLRDRINLPEIGFS VFLIFCASYNLIFHGKTSYYFNLYLQGLAFLLLGFNFTGNFACCQ
Uniprot No.

Target Background

Function
This protein is likely a mannan synthase, exhibiting 4-beta-mannosyltransferase activity on mannan using GDP-mannose as a substrate. The beta-1,4-mannan product serves as the backbone for galactomannan synthesis by galactomannan galactosyltransferase. Galactomannan is a noncellulosic polysaccharide found in plant cell walls.
Database Links

KEGG: osa:4343994

STRING: 39947.LOC_Os07g43710.1

UniGene: Os.8080

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like A subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular classification of CSLA7 and how does it relate to other cell wall biosynthesis enzymes?

CSLA7 belongs to the Cellulose Synthase-Like A (CSLA) family of glycosyltransferases, which are part of the larger group of processive polysaccharide β-glycosyltransferases in plants. These enzymes contain characteristic "D,D,D,QXXRW" motifs essential for their catalytic activity. CSLA proteins have been definitively identified as glucomannan synthases through both in vitro heterologous expression studies and in vivo mutant analysis .

The CSLA subfamily is one of six CSL subfamilies characterized in plants, all of which are thought to be involved in the synthesis of non-cellulosic plant cell wall polysaccharides. While cellulose synthesis is performed by the CESA family, the CSLA proteins specifically synthesize the glucomannan component of hemicelluloses. This classification is important when designing experiments targeting specific cell wall components, as different enzymes are responsible for the various polysaccharides found in plant cell walls .

What is the biochemical function of CSLA7 and what evidence supports this role?

CSLA7 functions as a glucomannan synthase, catalyzing the polymerization of GDP-mannose and GDP-glucose to form the β-1,4-linked backbone of glucomannan polysaccharides. This biochemical function has been established through multiple lines of evidence, including heterologous expression studies demonstrating mannan or glucomannan synthesis activity in vitro and mutant analyses showing glucomannan deficiency in csla knockout plants .

In Arabidopsis, CSLA7 specifically synthesizes glucomannan in embryos, as evidenced by the embryo-lethal phenotype of csla7 mutants and the ability of CSLA9 overexpression to complement this lethality . The essential nature of CSLA7 during embryogenesis strongly suggests that the glucomannan it produces serves a critical developmental function beyond the structural roles typically associated with cell wall polysaccharides .

What is the expression pattern of CSLA7 in Oryza sativa tissues and how does this compare to Arabidopsis?

Based on knowledge from Arabidopsis studies, CSLA7 likely exhibits a developmentally regulated expression pattern in rice. In Arabidopsis, AtCSLA7 is ubiquitously expressed, indicating its importance across multiple tissues and developmental stages . Particularly high expression would be expected in developing embryos and pollen tubes, given the critical role of CSLA7 in these tissues in Arabidopsis.

When designing expression studies for rice CSLA7, researchers should employ techniques such as quantitative RT-PCR, RNA-seq, or promoter-reporter fusions across various tissues and developmental stages. Special attention should be paid to reproductive tissues and developing seeds where expression might be most critical. Comparative expression analyses between rice and Arabidopsis can provide insights into conserved and divergent functions of CSLA7 between these species .

How can subcellular localization of rice CSLA7 be determined and what is its significance?

To determine the subcellular localization of rice CSLA7, researchers typically employ fluorescent protein fusion constructs (such as GFP or YFP fused to CSLA7) for transient or stable expression, followed by confocal microscopy. Alternative approaches include immunolocalization using specific antibodies against the native protein or epitope-tagged versions.

The subcellular localization of CSLA7 is significant because it indicates where glucomannan synthesis occurs within the cell. As a glycosyltransferase involved in cell wall polysaccharide synthesis, CSLA7 is expected to localize to the Golgi apparatus, which is the primary site for hemicellulose biosynthesis in plant cells. Confirmation of this localization would support its proposed function, while deviation might suggest additional or alternative roles for the protein .

What phenotypes are associated with CSLA7 mutations in rice and how do they compare with Arabidopsis findings?

Based on Arabidopsis studies, CSLA7 mutations in rice would likely produce severe developmental defects, particularly in embryogenesis. In Arabidopsis, homozygous csla7 mutants are embryo-lethal, with embryos arresting at the globular stage, showing abnormal cell patterning, and exhibiting defective endosperm development . Heterozygous plants show reduced transmission of the mutation through the male gametophyte, indicating CSLA7's importance for pollen tube growth .

When characterizing rice CSLA7 mutants, researchers should examine:

  • Embryo development using microscopic techniques to identify potential arrest points

  • Endosperm cellularization and proliferation

  • Pollen viability and tube growth

  • Seed set and transmission rates of the mutation

  • Glucomannan content in various tissues using biochemical analyses

Research in rice might reveal species-specific phenotypes due to potential functional divergence between rice and Arabidopsis CSLA7 orthologs .

What is the most effective approach for generating CSLA7 knockouts in rice for functional studies?

To generate CSLA7 knockouts in rice, several approaches can be considered, each with different advantages:

  • CRISPR/Cas9 gene editing: Currently the most efficient approach, allowing precise targeting of specific regions of the CSLA7 coding sequence. Multiple gRNAs can be designed to target conserved regions, particularly those encoding the catalytic "D,D,D,QXXRW" motifs critical for enzymatic function .

  • T-DNA or transposon insertional mutagenesis: If available, insertion lines can be screened for disruptions in the CSLA7 gene.

  • RNAi or antisense approaches: These may be preferable when studying essential genes, as they often result in partial knockdown rather than complete knockout, potentially avoiding embryo lethality.

Given the likely essential nature of CSLA7 in rice embryogenesis (based on Arabidopsis data), researchers should consider conditional knockout strategies such as inducible CRISPR systems or tissue-specific promoters to control the timing and location of gene silencing. Additionally, creating heterozygous knockout lines may be necessary if homozygous mutations prove lethal .

What are the optimal conditions for expressing and purifying recombinant rice CSLA7 protein?

For successful expression and purification of recombinant rice CSLA7, researchers should consider:

  • Expression system: Heterologous expression systems such as insect cells (Sf9 or High Five) often provide better results for plant membrane proteins like CSLA7 than bacterial systems. Mammalian cells or yeast (Pichia pastoris) are also viable alternatives that maintain proper protein folding and post-translational modifications.

  • Expression construct design:

    • Include a signal peptide for proper membrane insertion

    • Add an affinity tag (His6, GST, or FLAG) for purification

    • Consider truncating N-terminal transmembrane domains if they interfere with expression

    • Codon optimization for the selected expression system

  • Purification strategy:

    • Gentle detergent solubilization (DDM, CHAPS, or digitonin) to maintain protein activity

    • Affinity chromatography followed by size exclusion chromatography

    • Buffer optimization to maintain stability (glycerol, reducing agents)

    • Avoid harsh elution conditions that might denature the protein

When establishing purification protocols, researchers should verify protein activity at each step, as membrane proteins often lose functionality during purification. A functional assay measuring glucomannan synthase activity using radiolabeled or fluorescently labeled nucleotide sugars should be implemented to track active protein through the purification process .

How can the enzymatic activity of recombinant CSLA7 be reliably measured in vitro?

Measuring CSLA7 enzymatic activity requires careful experimental design:

  • Substrate preparation:

    • GDP-mannose and GDP-glucose as donor substrates

    • Potential acceptor molecules such as short mannooligosaccharides

  • Reaction conditions:

    • Buffer composition (typically with divalent cations like Mn²⁺ or Mg²⁺)

    • pH optimization (usually 6.5-7.5)

    • Temperature (25-30°C for plant enzymes)

    • Incubation time course to determine linear range

  • Activity detection methods:

    • Incorporation of radioactive substrates (¹⁴C or ³H-labeled GDP-sugars)

    • HPLC analysis of reaction products

    • Mass spectrometry to determine product structure

    • Coupled enzymatic assays detecting GDP release

  • Controls:

    • Heat-inactivated enzyme

    • Reactions lacking specific substrates

    • Known inhibitors of glycosyltransferases

The most definitive approach combines multiple detection methods to confirm both enzymatic activity and product identity. For example, size exclusion chromatography of reaction products combined with linkage analysis can confirm the synthesis of β-1,4-linked glucomannan polymers .

What post-translational modifications regulate CSLA7 activity and how can they be characterized?

Post-translational modifications (PTMs) likely play important roles in regulating CSLA7 activity, similar to other glycosyltransferases. Based on studies of related proteins, potential regulatory PTMs include:

  • Phosphorylation: CESA7, another cell wall biosynthetic enzyme, is regulated by phosphorylation which targets it for degradation through a proteasome-dependent pathway . To identify phosphorylation sites on CSLA7:

    • Immunoprecipitate the protein from plant tissues

    • Analyze using phospho-specific antibodies or mass spectrometry

    • Perform site-directed mutagenesis of potential phosphorylation sites

    • Compare enzymatic activity between phosphorylated and dephosphorylated forms

  • Glycosylation: As a protein trafficking through the secretory pathway, CSLA7 likely undergoes N-glycosylation. Methods to investigate this include:

    • Treatment with endoglycosidases followed by mobility shift analysis

    • Lectin binding assays

    • Mass spectrometry to identify glycosylated residues

  • Protein-protein interactions: CSLA7 activity may be modulated through interactions with other proteins. Techniques to explore this include:

    • Co-immunoprecipitation

    • Yeast two-hybrid screening

    • Bimolecular fluorescence complementation

The functional significance of identified modifications should be validated through mutagenesis studies and activity assays comparing wild-type and modified proteins .

How is CSLA7 expression regulated at the transcriptional level during plant development?

Transcriptional regulation of CSLA7 likely involves complex interactions between multiple transcription factors across different developmental stages. Based on studies of secondary cell wall biosynthetic genes, several approaches can be used to characterize this regulation:

  • Promoter analysis:

    • In silico identification of putative transcription factor binding sites

    • Generation of promoter-reporter constructs with serial deletions

    • Chromatin immunoprecipitation (ChIP) to identify proteins binding to the CSLA7 promoter

  • Transcription factor identification:

    • Yeast one-hybrid (Y1H) screening using the CSLA7 promoter as bait

    • Analysis of CSLA7 expression in transcription factor mutants

    • Co-expression analysis to identify transcription factors with expression patterns similar to CSLA7

  • Developmental regulation:

    • Tissue-specific and developmental stage-specific expression analysis

    • Response to hormones known to affect cell wall biosynthesis (e.g., ABA, JA)

    • Analysis of CSLA7 expression under various stress conditions

Recent studies have revealed that transcriptional regulation of cell wall biosynthesis genes is highly combinatorial, with multiple transcription factors binding to multiple promoters. For example, in Arabidopsis, members of the NAC and MYB transcription factor families have been identified as key regulators of cell wall biosynthetic genes .

What are the best approaches for studying CSLA7-synthesized glucomannans in rice cell walls?

To comprehensively study CSLA7-synthesized glucomannans in rice cell walls, researchers should employ a multi-faceted approach:

  • Extraction and quantification methods:

    • Sequential extraction with increasingly harsh solvents to fractionate cell wall components

    • Specific enzymatic hydrolysis using endo-β-mannanases

    • Quantification by colorimetric assays (phenol-sulfuric acid method)

    • HPAEC-PAD (High-Performance Anion Exchange Chromatography with Pulsed Amperometric Detection) for monosaccharide composition analysis

  • Structural characterization:

    • Linkage analysis via methylation followed by GC-MS

    • NMR spectroscopy for detailed structural information

    • MALDI-TOF MS for molecular weight determination

    • Enzymatic fingerprinting combined with HPLC

  • Visualization techniques:

    • Immunolabeling with mannan-specific antibodies (LM21, LM22)

    • Fluorescently labeled carbohydrate-binding modules specific for mannans

    • Confocal microscopy for tissue localization

    • Transmission electron microscopy for subcellular localization

  • Comparative analyses:

    • Comparison between wild-type and CSLA7 mutant/overexpression lines

    • Developmental time-course to capture dynamic changes

    • Tissue-specific differences in glucomannan content and structure

This comprehensive approach allows researchers to connect CSLA7 activity with specific structural features of the resulting glucomannans and their distribution within plant tissues .

How can CRISPR/Cas9 technology be optimized for studying CSLA7 function in rice?

CRISPR/Cas9 technology offers powerful approaches for studying CSLA7 function in rice, with several optimization strategies:

  • Guide RNA design considerations:

    • Target conserved catalytic domains for complete loss of function

    • Design multiple gRNAs targeting different exons to increase knockout efficiency

    • Use rice-optimized CRISPR systems with appropriate promoters

    • Employ CRISPOR or similar tools to minimize off-target effects

  • Advanced CRISPR applications:

    • Base editing for introducing specific amino acid changes without double-strand breaks

    • Prime editing for precise sequence modifications

    • Multiplex editing to target CSLA7 along with related family members for redundancy studies

    • Inducible or tissue-specific Cas9 expression to bypass embryo lethality

  • Phenotypic analysis strategies:

    • Generate chimeric plants if homozygous knockouts are lethal

    • Create conditional knockouts using heat-shock or chemical-inducible promoters

    • Develop tissue-specific knockouts to study CSLA7 function in specific developmental contexts

    • Use CRISPR interference (CRISPRi) for partial knockdown

  • Validation approaches:

    • Deep sequencing to verify editing efficiency

    • RT-qPCR and Western blotting to confirm reduced expression

    • Glucomannan content analysis to verify functional consequences

    • Complementation studies to confirm phenotype specificity

For essential genes like CSLA7, researchers should consider creating an allelic series with mutations of varying severity to understand structure-function relationships while avoiding complete lethality .

How does rice CSLA7 compare functionally to its orthologs in Arabidopsis and other plant species?

A comprehensive comparative analysis of CSLA7 across plant species reveals important evolutionary and functional insights:

  • Sequence conservation:

    • The catalytic "D,D,D,QXXRW" motifs are highly conserved across species

    • N-terminal transmembrane domains show greater variability

    • Substrate-binding regions may show differences that correlate with mannan/glucomannan ratio variations between species

  • Functional conservation and divergence:

    • In Arabidopsis, CSLA7 is essential for embryogenesis, with mutants exhibiting embryo arrest at the globular stage

    • The embryo lethality of Arabidopsis csla7 can be complemented by CSLA9 overexpression, suggesting similar catalytic functions but different expression patterns

    • Studies should investigate whether rice CSLA7 shows the same embryo-lethal phenotype or has evolved specialized functions

  • Expression pattern differences:

    • While Arabidopsis CSLA7 is ubiquitously expressed, rice CSLA7 expression patterns may differ

    • Comparative transcriptomics across species can reveal conserved and divergent regulatory mechanisms

    • Promoter swap experiments between rice and Arabidopsis CSLA7 can test functional equivalence

  • Substrate specificity:

    • Recombinant protein studies can determine if rice CSLA7 has the same preference for GDP-mannose and GDP-glucose substrates as its Arabidopsis counterpart

    • The mannose-to-glucose ratio in the resulting polysaccharides may differ between species

This comparative approach can reveal how CSLA7 function has evolved across plant lineages and provide insights into both conserved and species-specific aspects of glucomannan biosynthesis .

What complementation experiments would best determine the functional equivalence between rice and Arabidopsis CSLA7?

To rigorously test functional equivalence between rice and Arabidopsis CSLA7, several complementation strategies should be employed:

  • Cross-species complementation:

    • Expression of rice CSLA7 in Arabidopsis csla7 mutants under the Arabidopsis CSLA7 promoter

    • Assessment of rescue of embryo lethality, pollen tube growth defects, and glucomannan content

    • Quantitative measurements to determine if complementation is partial or complete

  • Domain swap experiments:

    • Creation of chimeric proteins with domains exchanged between rice and Arabidopsis CSLA7

    • Expression in respective mutant backgrounds

    • Identification of critical domains responsible for species-specific functions

  • Promoter swap experiments:

    • Expression of rice CSLA7 coding sequence under the Arabidopsis CSLA7 promoter and vice versa

    • Analysis of whether expression pattern differences account for any functional differences observed

  • Biochemical characterization:

    • Side-by-side in vitro activity assays of recombinant rice and Arabidopsis CSLA7

    • Comparison of substrate preferences, kinetic parameters, and product structures

    • Assessment of whether any biochemical differences correlate with in vivo phenotypic differences

These complementation approaches can definitively establish which aspects of CSLA7 function are conserved across species and which have diverged during evolution, providing insights into the core functions of this enzyme family in plant development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.