Recombinant Oryza sativa subsp. japonica Probable phytol kinase 1, chloroplastic (Os04g0670700, LOC_Os04g57500)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our protein products is influenced by a number of factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your requested tag.
Synonyms
Os04g0670700; LOC_Os04g57500; OSJNBa0043A12.34; Probable phytol kinase 1, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
63-314
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0670700
Target Protein Sequence
AALAASATPAALRDCAATLLITAGAYSLVRAFDGLTARRLIEQNLSRKIVHVLSGVLFMS SWPLFSNSTEARFFAAIVPLLNCIRLLTYGLRLSTDEALVKSVTREGKPEELLRGPLYYV IVLLVSVLVFWRQSPIGIVSLSMMSGGDGFADIVGRRYGSAKLPFNENKSWIGSISMFIS GFLLSALMLFYFSCLGYFTVCWDLALGKLALVALAATVVECIPVNDVVDDNISVPLATML AAYLLFGYSSCC
Uniprot No.

Target Background

Function
This protein plays a crucial role in the activation and reutilization of phytol derived from chlorophyll degradation in plant metabolism, including tocopherol biosynthesis. It catalyzes the conversion of phytol to phytol monophosphate (PMP).
Database Links
Protein Families
Polyprenol kinase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the phylogenetic relationship between rice Phytol Kinase 1 and related protein kinases in other species?

Phytol Kinase 1 in Oryza sativa belongs to a conserved family of protein kinases found across plant species. Comparative genomic analyses show that LOC_Os04g57500 is in proximity to LOC_Os04g57630, which has been identified as an orthologue of Arabidopsis PSKR1 (AtPSKR1) . While these are distinct kinases, their physical proximity on chromosome 4 suggests potential co-evolution or functional relationships. The rice kinome represents a diverse set of proteins, and systematic studies have cloned and tested 129 representative rice kinases for expression, with successful purification achieved for approximately 31% (40 out of 129) .

When analyzing phylogenetic relationships, researchers should consider both sequence homology and functional conservation. Closely related kinases in rice and Arabidopsis often share conserved catalytic domains despite divergent regulatory regions, reflecting their adaptation to species-specific signaling pathways.

How can we accurately identify and characterize the substrate specificity of Phytol Kinase 1?

Determining substrate specificity requires multiple complementary approaches. Begin with in vitro kinase assays using purified recombinant LOC_Os04g57500 protein and candidate substrates. Thermal shift assays, such as differential scanning fluorimetry (DSF), can provide insights into kinase-substrate interactions by measuring changes in protein stability upon substrate binding .

For in vivo validation, consider using transgenic rice lines with altered expression of LOC_Os04g57500, followed by phosphoproteomic analysis to identify differentially phosphorylated proteins. Comparison with known kinase-substrate pairs, such as phytochrome A and PIF3, can provide methodological guidance . The critical aspect of this research is validating putative substrates through multiple lines of evidence rather than relying on a single experimental approach.

What experimental systems are most appropriate for studying the function of chloroplastic kinases in rice?

For in vivo studies, transgenic rice (cv. Kitaake) offers advantages as it matches the genetic background of the native kinase . When working with chloroplastic proteins, researchers should incorporate organelle isolation protocols to maintain native conditions. Fluorescent protein fusions can confirm chloroplastic localization, while split-GFP or FRET approaches can identify interaction partners within the chloroplast.

Comparative studies in Arabidopsis can provide complementary insights, especially when examining conserved functions, as demonstrated in studies of kinase inhibitors affecting root development across plant species .

What are the most effective protocols for cloning and expressing rice chloroplastic kinases?

Ligation-independent cloning (LIC) has proven effective for high-throughput cloning of rice kinases . When designing constructs for chloroplastic kinases like LOC_Os04g57500, consider these methodological steps:

  • Include the chloroplast transit peptide if studying the complete protein, or exclude it if focusing only on catalytic activity.

  • Optimize codon usage for the expression system (E. coli codons differ significantly from plant-preferred codons).

  • Add purification tags (e.g., His6) that can be cleaved post-purification to avoid interference with kinase activity.

  • Include TEV protease recognition sites for tag removal.

For expression, BL21(DE3) E. coli strains with chaperone co-expression can improve folding of plant proteins. Lower induction temperatures (16-18°C) often increase soluble protein yield. When encountering expression difficulties, consider testing multiple construct designs with varying N- and C-terminal boundaries .

How can researchers screen for inhibitors of Phytol Kinase 1 and validate their specificity?

Differential scanning fluorimetry (DSF) provides an efficient first-pass screening method for identifying potential kinase inhibitors. In a systematic study of rice kinases, researchers screened 40 purified kinases against 627 diverse inhibitors, identifying compounds with varying binding affinities .

To screen inhibitors specifically for LOC_Os04g57500:

  • Express and purify the recombinant protein in sufficient quantities (typically 1-5 mg).

  • Conduct DSF assays with a diverse chemical library, monitoring thermal stability shifts (ΔTm).

  • Validate hits through secondary assays such as activity-based methods or isothermal titration calorimetry (ITC).

  • Test physiological effects in planta, similar to approaches used for PSKR1 inhibitors that affected root development .

For specificity validation, screen against closely related kinases and test effects in knockout/knockdown plants versus wild-type. The example of compounds #24 (Hesperadin) and #37 (Sitravatinib) binding to LOC_Os04g57630 demonstrates how inhibitor binding can inform biological function .

What approaches are most effective for measuring kinase activity of recombinant LOC_Os04g57500?

Multiple complementary methods should be employed to comprehensively characterize kinase activity:

  • Autophosphorylation assays: Monitor self-phosphorylation using radiolabeled ATP (γ-32P-ATP) or phospho-specific antibodies.

  • Substrate phosphorylation: Quantify phosphate transfer to synthetic peptides or putative protein substrates.

  • ATPase activity measurements: Assess ATP hydrolysis rate using colorimetric assays (e.g., malachite green).

  • Thermal shift analysis: Measure conformational changes upon ATP binding to evaluate catalytic competence .

When analyzing data, consider both Vmax and Km parameters to characterize enzyme efficiency. For plant kinases, activity can be significantly affected by experimental conditions, particularly pH, divalent cation concentration, and redox state. The approach used for phytochrome A, where kinase activity positively correlated with photoresponses, provides a methodological framework for connecting biochemical activity to physiological function .

How do inhibitors of Phytol Kinase 1 affect rice development compared to effects observed in Arabidopsis?

Comparative phenotypic analysis between rice and Arabidopsis can reveal conserved and divergent functions of kinase inhibitors. In a recent study, 37 active compounds identified through kinase binding assays were tested for effects on Arabidopsis root development . Of these, 14 compounds significantly reduced primary root length while two slightly increased root elongation.

For comparative studies with LOC_Os04g57500, researchers should:

  • Establish dose-response curves in both rice and Arabidopsis seedlings.

  • Quantify multiple developmental parameters beyond root length (lateral root formation, shoot development, chloroplast function).

  • Compare phenotypes with genetic knockout/knockdown lines.

  • Analyze tissue-specific expression patterns in both species to identify potential sites of action.

The finding that inhibitors of PSKR1 (similar to LOC_Os04g57630) affected root development highlights how targeted chemical inhibition can reveal biological functions . When designing such experiments, control for species-specific differences in compound uptake, metabolism, and tissue distribution.

How can researchers analyze contradictory data regarding the kinase activity or function of LOC_Os04g57500?

Contradictory results are common in kinase research due to methodological differences, genetic background variations, or environmental factors. When faced with contradictory data:

  • Systematically compare methodologies: Even small differences in protein preparation, buffer composition, or assay conditions can significantly impact kinase activity measurements.

  • Consider genetic background effects: As seen in studies of seed dormancy QTLs in rice, genetic background can dramatically influence phenotypic manifestations of genetic variants .

  • Apply statistical approaches from contradiction analysis: Strategies used in logical reasoning studies can be adapted to evaluate contradictory scientific results .

The table below outlines an approach for resolving contradictions based on statistical principles:

Contradiction TypeAnalytical ApproachSuccess Rate (%)Response Time (log s)
Universal contradictionSystematic comparison98.0 ± 3.22.74 ± 0.007 (550 ms)
Particular contradictionCase-specific analysis97.5 ± 1.92.69 ± 0.006 (490 ms)

Adapting methods from logical contradiction analysis , researchers can systematically evaluate contradictory findings to determine whether discrepancies result from methodological differences or represent true biological complexity.

What role might Phytol Kinase 1 play in chloroplast-nuclear signaling pathways?

As a chloroplastic protein, LOC_Os04g57500 likely participates in retrograde signaling from chloroplasts to the nucleus. Research approaches to investigate this include:

  • Transcriptomic analysis: Compare nuclear gene expression profiles between wild-type and LOC_Os04g57500 mutants under various light conditions.

  • Phosphoproteomic studies: Identify differential protein phosphorylation in chloroplasts and cytosol.

  • Metabolite profiling: Analyze changes in chloroplast-derived signaling molecules.

  • Protein-protein interaction studies: Identify potential binding partners that shuttle between chloroplast and nucleus.

Drawing parallels from phytochrome signaling research, where kinase activity positively correlates with photoresponses , similar experimental designs could be applied to LOC_Os04g57500. The connections between light signaling, kinase activity, and developmental responses provide a conceptual framework for investigating chloroplastic kinases.

What are the key challenges in expressing and purifying active recombinant LOC_Os04g57500?

Chloroplastic proteins present unique challenges for recombinant expression. Based on systematic studies of rice kinases, only about 31% of tested kinases achieved sufficient expression and purification for functional studies . Key challenges and solutions include:

  • Protein solubility: Chloroplastic proteins often form inclusion bodies in bacterial expression systems. Solutions include lower induction temperatures (16°C), co-expression with chaperones, and fusion with solubility-enhancing tags.

  • Proper folding: The reducing environment of E. coli cytoplasm differs from the chloroplast stroma. Consider using specialized strains with modified redox environments or refolding protocols.

  • Post-translational modifications: If phosphorylation affects activity, consider co-expression with phosphatases or kinases, or use eukaryotic expression systems.

  • Transit peptide complications: The chloroplast transit peptide might interfere with proper folding. Test constructs with and without the transit sequence.

A systematic approach that tests multiple expression conditions and construct designs has proven most effective for challenging kinases .

How can genome editing techniques be optimized for studying LOC_Os04g57500 function in vivo?

CRISPR/Cas9 editing of rice genes requires careful optimization for studying chloroplastic kinases:

  • Guide RNA design: Target conserved regions of the catalytic domain rather than the transit peptide to ensure loss of function.

  • Rice transformation: Japonica cultivars like Kitaake offer higher transformation efficiency compared to indica varieties .

  • Phenotypic analysis: Focus on chloroplast-related phenotypes (photosynthetic parameters, chlorophyll content, response to light stress).

  • Complementation controls: Include rescue experiments with the wild-type gene to confirm specificity.

When interpreting results, consider that chloroplastic proteins may have pleiotropic effects due to their fundamental role in plant metabolism. The approach used for seed dormancy and shattering QTL analysis in rice provides methodological guidance for connecting genomic variation with phenotypic traits .

What data analysis approaches are most appropriate for interpreting complex phenotypic effects of LOC_Os04g57500 mutations?

Rice phenotyping generates complex, multi-dimensional datasets that require sophisticated analysis:

  • Principal Component Analysis (PCA): Reduce dimensionality while preserving relationships between multiple phenotypic parameters.

  • Random Forest classification: Identify the most informative phenotypic features distinguishing mutant from wild-type.

  • Time-series analysis: Capture developmental dynamics rather than endpoint measurements.

  • Multi-environment testing: Evaluate phenotypes under various stresses to reveal condition-specific functions.

When working with sequencing data, the approach used for whole-genome re-sequencing and reads mapping in rice provides a robust framework :

Analysis ParameterTypical Values for RiceApplication to LOC_Os04g57500
Sequencing depth17.78-38.88 foldMinimum 30-fold for reliable variant detection
Genome coverage91.94-96.60%Focus coverage on LOC_Os04g57500 locus
Unique reads mapped93.52-97.02%Essential for accurate variant calling

Multi-omics integration (combining transcriptomics, proteomics, and metabolomics) provides the most comprehensive view of kinase function in complex biological systems.

How might studying LOC_Os04g57500 contribute to understanding chloroplast evolution in cereals?

Comparative analysis of chloroplastic kinases like LOC_Os04g57500 across cereal species can provide insights into chloroplast evolution and adaptation. Research approaches should include:

  • Phylogenomic analysis of homologous sequences across diverse grass species.

  • Comparison of selection pressures on different protein domains.

  • Investigation of neo- or sub-functionalization events in duplicated kinase genes.

  • Correlation of sequence variations with species-specific physiological adaptations.

The evolutionary analysis of kinase genes can be informed by approaches used for phytosulfokine genes, where DNA blot analysis demonstrated that homologs exist in both monocot and dicot plants . Understanding the evolutionary trajectory of chloroplastic kinases may reveal how plants adapted their photosynthetic apparatus to diverse environmental conditions.

What emerging technologies might revolutionize our understanding of chloroplastic kinase functions?

Several cutting-edge technologies are poised to advance research on chloroplastic kinases:

  • Single-cell proteomics: Revealing cell-type specific functions of LOC_Os04g57500 within complex tissues.

  • Organelle-specific CRISPR: Targeted editing of chloroplast-localized proteins without affecting nuclear genes.

  • Proximity labeling techniques: Identifying interaction partners specifically within the chloroplast compartment.

  • Computational protein structure prediction: AlphaFold2 and similar tools can predict structures of chloroplastic kinases to inform function and drug design.

  • Optogenetic control: Light-activatable kinase variants for temporal and spatial regulation of activity.

These approaches, combined with established rice genetics tools, will provide unprecedented insights into the roles of chloroplastic kinases in plant development and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.