Recombinant Oryza sativa subsp. japonica Probable phytol kinase 2, chloroplastic (Os01g0832000, LOC_Os01g61560)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa subsp. japonica Probable Phytol Kinase 2, Chloroplastic (Os01g0832000, LOC_Os01g61560)

The probable phytol kinase 2, chloroplastic (UniProt: Q5N9J9) is a recombinant protein derived from Oryza sativa subsp. japonica (rice), expressed in E. coli with an N-terminal His tag. It is involved in phytol metabolism, catalyzing the phosphorylation of free phytol to phytol monophosphate (PMP), a critical step in recycling phytol released during chlorophyll degradation . This enzyme plays a role in redirecting phytol into chloroplast lipid biosynthesis, including tocopherol (vitamin E) synthesis .

Biochemical Function

  • Catalytic Activity: Phosphorylates phytol to PMP using CTP as a nucleotide donor, with broader specificity for ATP, GTP, and UTP in subsequent steps (e.g., PMP to phytyl-diphosphate) .

  • Metabolic Role:

    • Chlorophyll Degradation: Recycles phytol released during senescence into chloroplast lipid pathways.

    • Tocopherol Biosynthesis: PMP serves as a precursor for tocopherol synthesis, essential for antioxidant defense .

    • Lipid Ester Formation: Excess phytol is incorporated into fatty acid esters, which accumulate during senescence .

Experimental Uses

ApplicationDetails
Enzyme KineticsIn vitro assays to study substrate specificity (CTP, ATP, GTP, UTP) .
Metabolic Pathway StudiesInvestigates phytol reutilization in chloroplast lipid biosynthesis .
Protein InteractionsStructural studies to elucidate binding partners in phytol metabolism .

Key Research Insights

  • Salvage Pathway Efficiency: Phytol kinase activity enables efficient recycling of phytol, bypassing de novo synthesis from geranylgeranyl-diphosphate .

  • Chloroplast Localization: The enzyme is associated with chloroplast envelope membranes, ensuring proximity to phytol sources .

  • Regulatory Mechanisms: Phosphorylation-dependent regulation of phytol flux into tocopherols or esters may influence stress responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the most accurate delivery time.
Note: All protein shipments are sent with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
Os01g0832000; LOC_Os01g61560; P0446G04.41; Probable phytol kinase 2, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
60-304
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0832000
Target Protein Sequence
AAAIPPEASGLAHDLGSAAVTAGVALALLRFFEELAKRGVFEQKLNRKLVHITIGMVFLL FWPLFSSGSYAPFLAAVAPGINIIRMLLLGLGVMKNEAMVKSMSRSGDPRELLKGPLYYA TTITFATSIFWRTSPIAIALICNLCAGDGIADIVGRRLGQEKLPYNPNKSYAGSIAMALA GFMASIGYMHYFQSFGFIEESWSLAFGFLVVSVTAALVESHPISTHLDDNLTVPLTSFLV GSLVF
Uniprot No.

Target Background

Function
This protein plays a crucial role in activating and reusing phytol from chlorophyll degradation within plant metabolism, including tocopherol biosynthesis. It catalyzes the conversion of phytol to phytol monophosphate (PMP).
Database Links
Protein Families
Polyprenol kinase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What are the recommended experimental conditions for working with recombinant Os01g0832000?

When working with recombinant Os01g0832000 protein, consider these methodological guidelines:

  • Storage conditions: Store lyophilized protein at -20°C/-80°C upon receipt. After reconstitution, store working aliquots at 4°C for up to one week .

  • Reconstitution protocol: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C to prevent protein degradation through repeated freeze-thaw cycles .

  • Buffer compatibility: The recombinant protein is typically provided in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability .

These conditions ensure optimal protein stability and activity for experimental applications.

What experimental systems can be used to study Os01g0832000 function?

Several experimental systems can be employed to study Os01g0832000 function:

  • In vitro enzymatic assays: Using purified recombinant protein to assess phytol kinase activity by measuring phosphorylated phytol products through techniques like HPLC or mass spectrometry.

  • Gene overexpression: Generating transgenic rice plants overexpressing Os01g0832000 to observe phenotypic effects on plant development, particularly root architecture based on findings from similar studies .

  • Gene knockout/knockdown: Creating loss-of-function mutants using CRISPR-Cas9 or RNAi to examine the consequences of reduced Os01g0832000 function.

  • Protein-protein interaction studies: Using techniques such as yeast two-hybrid, co-immunoprecipitation, or pull-down assays to identify proteins that interact with Os01g0832000 .

  • Subcellular localization: Confirming the chloroplastic localization using GFP fusion proteins and confocal microscopy.

The choice of experimental system should align with the specific research question being addressed.

How does Os01g0832000 contribute to rice root architecture development?

Recent studies suggest that lipid mediators like Os01g0832000 play important roles in rice root architecture development. While not directly studying Os01g0832000, research on related lipid mediators like diacylglycerol kinase (DGK1) provides insights into how such enzymes might function:

DGK1 phosphorylates diacylglycerol (DAG) to generate phosphatidic acid (PA), and both of these lipid mediators impact root development in rice. Studies have shown that:

  • Knockouts of related genes led to higher density of lateral roots (LRs) and thinner seminal roots (SRs) .

  • Overexpression resulted in lower LR density and thicker SRs compared to wild-type plants .

  • Changes in the balance of lipid mediators (DAG and PA) directly affected root phenotypes .

Given the chloroplastic localization of Os01g0832000 and its role as a kinase, it may similarly influence lipid mediator balance affecting root development. Research methodologies should include:

  • Creating transgenic lines with altered Os01g0832000 expression

  • Detailed phenotypic analysis of root architecture parameters

  • Lipidomic analysis to track changes in relevant phosphorylated compounds

  • Application of exogenous lipid mediators to rescue phenotypes

These approaches would help establish direct links between Os01g0832000 function and root development.

What is the role of Os01g0832000 in plant responses to nitrogen availability?

Proteomic studies have identified Os01g0832000 as differentially regulated in response to nitrogen treatments in rice. In a study comparing transgenic Bt rice (T2A-1) with its non-transgenic counterpart (MH63) under various nitrogen conditions, Os01g0832000 protein showed significant upregulation:

DescriptionAccessionCoverage (%)Unique PeptidesPeptidesaverage N-LL/N-MH63Significance A
Os01g0832000 proteinQ0JI112.85111.8680.001

This data indicates that Os01g0832000 showed an 86.8% increase in abundance in nitrogen-treated plants compared to controls, with a significance value of 0.001 .

Methodologically, researchers investigating this connection should:

  • Perform RT-qPCR analysis of Os01g0832000 expression under various nitrogen regimes

  • Analyze enzyme activity across nitrogen treatments

  • Examine changes in chloroplast metabolism as nitrogen availability fluctuates

  • Investigate whether Os01g0832000 influences nitrogen use efficiency metrics

  • Study the phenotypes of Os01g0832000 mutants under nitrogen limitation

The significant upregulation under nitrogen treatment suggests this enzyme may be part of adaptive responses to nutrient availability, possibly through adjustments in chloroplast lipid metabolism.

How does Os01g0832000 interact with other proteins in plant immunity and stress response pathways?

Although direct evidence for Os01g0832000's role in immunity is limited in the provided search results, we can develop methodological approaches based on findings about related proteins involved in rice immunity pathways:

Research on S-domain receptor-like kinases like SPL11 cell-death suppressor 2 (SDS2) has shown they positively regulate programmed cell death (PCD) and immunity in rice . Given that Os01g0832000 was identified in proteomic studies of stress responses, it may function in related pathways.

Methodology for investigating Os01g0832000's role in immunity should include:

  • Protein-protein interaction studies: Use co-immunoprecipitation, yeast two-hybrid screens, or proximity labeling approaches to identify interacting partners of Os01g0832000.

  • Pathogen challenge experiments: Challenge Os01g0832000 overexpression and knockout lines with common rice pathogens to observe differences in disease resistance.

  • ROS (reactive oxygen species) burst assays: Determine whether Os01g0832000 affects production of ROS during pathogen attack, similar to how OsRLCK118 functions in PTI signaling .

  • Transcriptomic analysis: Perform RNA-seq of Os01g0832000 mutants under pathogen challenge to identify differentially regulated defense genes.

  • Phosphorylation studies: Investigate whether Os01g0832000 undergoes phosphorylation during immune responses and identify potential kinases responsible.

These approaches would help establish whether Os01g0832000 functions within immunity pathways, possibly through regulation of lipid signaling in chloroplasts during stress responses.

What are the optimal experimental designs for functional characterization of Os01g0832000 in rice development?

For comprehensive functional characterization of Os01g0832000, a multi-faceted experimental approach is recommended:

A. Genetic manipulation approaches:

  • Generate CRISPR/Cas9 knockout lines of Os01g0832000

  • Create overexpression lines using constitutive (e.g., CaMV 35S, Ubiquitin) and tissue-specific promoters

  • Develop inducible expression systems to control Os01g0832000 activity temporally

B. Phenotypic characterization:

  • Detailed analysis of growth parameters including:

    • Root architecture (lateral root density, seminal root thickness)

    • Shoot development

    • Chlorophyll content and photosynthetic efficiency

    • Seed setting and yield components

C. Biochemical characterization:

  • Enzymatic assays to confirm phytol kinase activity:

    • In vitro assays with purified recombinant protein

    • Measurement of substrate (phytol) and product (phosphorylated phytol) levels in vivo

    • Determination of kinetic parameters (Km, Vmax)

D. Stress response analysis:

  • Challenge plants with:

    • Nitrogen limitation/excess

    • Pathogen infection

    • Abiotic stressors (drought, salinity, temperature)

  • Measure physiological responses and Os01g0832000 expression/activity changes

E. Molecular interaction studies:

  • Identify protein-protein interactions using:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • BiFC (Bimolecular Fluorescence Complementation) in planta

F. Subcellular localization:

  • Confirm chloroplastic localization using fluorescent protein fusions

  • Investigate potential dynamic relocalization under different conditions

This comprehensive approach would provide a thorough understanding of Os01g0832000 function in rice development and stress responses.

How do post-translational modifications affect Os01g0832000 activity and stability?

Understanding post-translational modifications (PTMs) of Os01g0832000 is crucial for comprehending its regulation. While specific information about PTMs of Os01g0832000 is limited in the provided search results, methodological approaches for investigating this aspect include:

A. Identification of potential PTMs:

  • Use predictive algorithms to identify potential phosphorylation, glycosylation, and other modification sites in the Os01g0832000 sequence

  • Perform mass spectrometry analysis of purified native protein to identify actual PTMs

  • Compare PTM patterns under different physiological conditions (e.g., nitrogen stress, pathogen attack)

B. Functional analysis of PTMs:

  • Generate site-directed mutants of predicted PTM sites:

    • Phospho-null mutants (Ser/Thr/Tyr to Ala)

    • Phospho-mimetic mutants (Ser/Thr to Asp/Glu)

  • Assess the enzymatic activity of wild-type vs. mutant proteins

  • Evaluate protein stability and turnover rates of modified vs. unmodified forms

C. Identification of modifying enzymes:

  • Screen kinase/phosphatase libraries for enzymes that modify Os01g0832000

  • Perform co-immunoprecipitation experiments to identify physically interacting modifying enzymes

  • Validate interactions using in vitro modification assays

D. Physiological relevance:

  • Express PTM-site mutants in Os01g0832000 knockout background

  • Assess complementation efficiency under normal and stress conditions

  • Determine if PTMs affect protein localization or interaction patterns

Through these methodological approaches, researchers can uncover how PTMs regulate Os01g0832000 activity, stability, and function in rice plants, providing insights into the molecular mechanisms controlling phytol metabolism in chloroplasts.

What are the comparative differences in Os01g0832000 function across rice subspecies and related cereal crops?

Investigating the evolutionary conservation and functional divergence of Os01g0832000 across different rice subspecies and related cereals provides valuable insights into its fundamental importance and potential adaptation to different environments. Methodological approaches include:

A. Comparative genomic analysis:

  • Identify homologs in:

    • Different rice subspecies (japonica vs. indica)

    • Other cereal crops (wheat, maize, barley)

    • Model plants (Arabidopsis)

  • Perform phylogenetic analysis to understand evolutionary relationships

  • Calculate selection pressures (Ka/Ks ratios) to identify conserved functional domains

B. Expression pattern comparison:

  • Compare tissue-specific expression patterns across species

  • Analyze expression responses to environmental stressors

  • Determine if alternative splicing varies between species

C. Functional complementation:

  • Express homologs from different species in Os01g0832000 rice knockout background

  • Assess degree of functional complementation

  • Identify species-specific functional differences

D. Biochemical comparison:

  • Express and purify recombinant proteins from different species

  • Compare enzymatic parameters (substrate specificity, catalytic efficiency)

  • Evaluate structural differences through protein modeling

E. Phenotypic analysis in different genetic backgrounds:

  • Create RNAi or CRISPR knockdowns in multiple species

  • Compare resulting phenotypes to identify conserved vs. divergent functions

  • Assess whether stress responses mediated by this gene vary between species

This comparative approach would reveal whether Os01g0832000 function is strictly conserved or has undergone functional diversification during cereal crop evolution, providing insights into its fundamental importance in plant metabolism.

How does Os01g0832000 contribute to chloroplast lipid homeostasis in rice?

As a chloroplastic phytol kinase, Os01g0832000 likely plays a crucial role in chloroplast lipid metabolism. Based on its predicted function and cellular localization, we can outline methodological approaches to investigate its contribution to chloroplast lipid homeostasis:

A. Lipid profiling analysis:

  • Perform comprehensive lipidomic analysis of:

    • Wild-type plants

    • Os01g0832000 knockout mutants

    • Os01g0832000 overexpression lines

  • Focus specifically on chloroplast membrane lipids and phytol-derived compounds

  • Analyze changes under different environmental conditions (light, temperature, stress)

B. Chloroplast structure and function assessment:

  • Examine chloroplast ultrastructure using transmission electron microscopy (TEM)

  • Measure photosynthetic parameters (quantum yield, electron transport rate, NPQ)

  • Analyze chlorophyll and tocopherol content (compounds derived from phytol metabolism)

C. Metabolic flux analysis:

  • Use isotope-labeled precursors to track phytol metabolism

  • Compare metabolic flux through phytol kinase pathway in wild-type vs. mutant plants

  • Identify rate-limiting steps and metabolic bottlenecks

D. Protein localization within chloroplasts:

  • Determine precise sub-chloroplastic localization (thylakoid, envelope, stroma)

  • Identify potential protein complexes involved in lipid metabolism

  • Assess dynamic changes in localization under stress conditions

E. Molecular modeling and substrate specificity:

  • Generate structural models of Os01g0832000

  • Perform docking studies with various substrates

  • Create targeted mutations to alter substrate specificity

  • Validate predictions with enzymatic assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.