Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 32 (Os03g0292100, LOC_Os03g18150)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 32, also known as Os03g0292100 or LOC_Os03g18150, is a protein phosphatase 2C (PP2C) found in Oryza sativa subsp. japonica (rice) . PP2Cs are a family of serine/threonine phosphatases that play a role in various signaling pathways in plants .

Basic Characteristics

CharacteristicDescription
Product CodeCSB-CF608878OFG
UniProt No.Q10MX1
Immunogen SpeciesOryza sativa subsp. japonica (Rice)
SequenceMSCTVAIPSSPVFSPSRRPLSCKAASASASPESVSVAASSPAQAAPPAGSPLRPFALRAHLREEATPSPQPSAAAAAAVSAPAGSVLKRRRPAPLVVPVCGGAAAAAAAAAVAAVESDPRNEVEEDGEEFAVYCRRGKGRRRVEMEDRHVAKVALGGDPKVAFFGVFDGHGGKSAAEFVAENMPKFMAEEMCKVDGGDSGETEQAVKRCYLKTDEEFLKREESGGACCVTALLQKGGLVVSNAGDCRAVLSRAGKAEALTSDHRASREDERERIENLGGFVVNYRGTWRVQGSLAVSRGIGDAHLKQWVVSDPDTTTLGVDSQCEFLILASDGLWDKVENQEAVDIARPLYISNDKASRMTACRRLVETAVTRGSTDDISIVIIQLQQFSR
Sourcein vitro E. coli expression system
Target NamesOs03g0292100
Protein NamesProbable protein phosphatase 2C 32; Short name= OsPP2C32 EC= 3.1.3.16
Expression Region1-391
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
StorageStore at -20°C; for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week .
Shelf LifeLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
Product TypeTransmembrane Protein

Function and Significance

The protein is a member of the PP2C family, which are known to be important in plant signaling pathways . These phosphatases are involved in regulating responses to environmental stresses and hormones . For instance, glutamate induces the expression of multiple genes in nitrogen-starved rice seedlings, suggesting that amino acid signaling pathways may interact with stress signaling networks .

Expression and Regulation

The expression of genes, including protein phosphatase 2C, can be rapidly induced by exogenous glutamate in nitrogen-starved rice seedlings . After 15 minutes of glutamate treatment, the amounts of glutamine, aspartate, and alanine increase rapidly .

Related Research

Locus IDFold Change (+ Glu/- N)Gene Description
Os03g02362009.6Glutamate decarboxylase 1, GDC1
Os08g05088005.4Herbivore induced 13-lipoxygenase, HI-LOX
Os12g05182005.1EamA-like transporter family
Os04g06184005.1Unknown
Os03g08234004.7Bowman-Birk type trypsin inhibitor, BBTI13
Os09g04010004.6MYB family transcription factor
Os05g04029004.3Xylanase inhibitor I-like
Os01g01869004.2Putative nuclease HARBI1
Os08g04572004.2Unknown
Os05g03733003.9Copine-like protein; similar to BONZAI1
Os01g09529003.8Unknown
Os01g07052003.7Late embryogenesis abundant protein, group 3
Os12g01815003.7Amino acid permease 16, AAP16
Os01g06660003.6Lipid phosphate phosphatase 2
Os03g03184003.6Aspartic proteinase nepenthesin-1
Os04g03015003.6Transcription factor bHLH35, RERJ1
Os02g02696003.6Subtilisin-like protease SBT3.5
Os09g05653003.5E3 ubiquitin-protein ligase RGLG1
Os10g05429003.5Chitinase 8
Os02g06059003.4Chitinase 6
Os09g05510003.3G-type lectin S-receptor-like protein kinase RKS1
Os01g08451003.3Protein of unknown function DUF668
Os11g02138003.2NBS-LRR disease resistance protein
Os03g03028003.2Unknown
Os02g06872003.1Protein of unknown function DUF581
Os01g09053003.1Exo70 exocyst complex subunit
Os10g04977003.1COBRA-like protein 4
Os02g07339003.1Unknown
Os04g05850003.0RING-H2 finger protein ATL44
Os05g05167003.0Unknown
Os03g01878003.0Purine permease 3, PUP3
Os04g06479003.0LRR receptor-like serine/threonine protein kinase GSO1
Os01g07057002.9Transcription factor bHLH13
Os10g04181002.9Calcium-transporting ATPase 13
Os07g05597002.9Monosaccharide transporter 6, OsMST6
Os11g01449002.9Unknown
Os04g04641002.8Heavy metal transport domain-containing protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Os03g0292100; LOC_Os03g18150; Probable protein phosphatase 2C 32; OsPP2C32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os03g0292100
Target Protein Sequence
MSCTVAIPSSPVFSPSRRPLSCKAASASASPESVSVAASSPAQAAPPAGSPLRPFALRAH LREEATPSPQPSAAAAAAVSAPAGSVLKRRRPAPLVVPVCGGAAAAAAAAAVAAVESDPR NEVEEDGEEFAVYCRRGKGRRRVEMEDRHVAKVALGGDPKVAFFGVFDGHGGKSAAEFVA ENMPKFMAEEMCKVDGGDSGETEQAVKRCYLKTDEEFLKREESGGACCVTALLQKGGLVV SNAGDCRAVLSRAGKAEALTSDHRASREDERERIENLGGFVVNYRGTWRVQGSLAVSRGI GDAHLKQWVVSDPDTTTLGVDSQCEFLILASDGLWDKVENQEAVDIARPLYISNDKASRM TACRRLVETAVTRGSTDDISIVIIQLQQFSR
Uniprot No.

Target Background

Database Links
Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the role of Os03g0292100 (PP2C 32) in ABA signaling?

Os03g0292100 likely functions as a negative regulator in the ABA signaling pathway, similar to other group A PP2Cs. Based on studies of PP2C proteins in rice, this phosphatase probably interacts physically with SnRK2s and inactivates them through dephosphorylation of multiple Ser/Thr residues in their activation loop . The activity would typically be suppressed by RCAR/PYR ABA receptors in response to ABA, allowing SnRK2s to activate downstream signaling. To investigate this mechanism with Os03g0292100 specifically, researchers should:

  • Conduct in vitro phosphatase assays using recombinant Os03g0292100 and phosphorylated SnRK2 substrates

  • Perform co-immunoprecipitation experiments to confirm physical interactions with SnRK2s and ABA receptors

  • Use phospho-specific antibodies to monitor the phosphorylation state of SnRK2s in the presence and absence of active Os03g0292100

How is Os03g0292100 expression regulated under various abiotic stresses?

Based on comprehensive studies of PP2C genes in rice, numerous members show differential expression patterns under salinity, cold, and drought stress conditions . To determine the specific expression profile of Os03g0292100:

  • Perform quantitative real-time PCR (qRT-PCR) analysis of Os03g0292100 expression in rice seedlings subjected to different abiotic stresses (drought, salinity, cold) at multiple time points (0h,.5h, 3h, 6h, 12h, and 24h)

  • Compare expression changes with ABA treatment to determine if the regulation is ABA-dependent

  • Use promoter-GUS fusion constructs to visualize tissue-specific expression patterns under different stress conditions

  • Analyze public microarray or RNA-seq datasets to corroborate your findings and compare with other PP2C family members

What is the subcellular localization of Os03g0292100 and how can it be determined?

Understanding the subcellular localization of Os03g0292100 is crucial for elucidating its function. Based on studies of other PP2C proteins, it may localize to the nucleus, cytoplasm, or both . To determine its localization:

  • Generate fluorescent protein fusions (e.g., YFP-Os03g0292100) and express them transiently in Nicotiana benthamiana leaves

  • Create stable transgenic rice lines expressing the fusion protein under native or constitutive promoters

  • Perform confocal microscopy to visualize the subcellular distribution

  • Confirm localization using cellular fractionation followed by Western blot analysis

  • Consider co-localization studies with known interaction partners (e.g., SnRK2s, ABA receptors) to understand the spatial context of signaling complexes

How does the three-dimensional structure of Os03g0292100 contribute to its substrate specificity?

Understanding the structural basis of substrate recognition is essential for determining how Os03g0292100 functions specifically within the large PP2C family. To investigate:

  • Express and purify recombinant Os03g0292100 protein for crystallization studies

  • Determine the crystal structure in both apo form and in complex with substrate peptides

  • Conduct molecular dynamics simulations to identify key residues involved in substrate recognition

  • Perform site-directed mutagenesis of predicted substrate-binding residues and assess the effect on phosphatase activity toward different substrates

  • Compare the structural features with other PP2Cs that have known structures to identify unique features

The table below shows predicted key structural elements of Os03g0292100 compared to other characterized PP2Cs:

Structural ElementOs03g0292100 (Predicted)ABI1 (Arabidopsis)HAB1 (Arabidopsis)Functional Significance
Mn²⁺/Mg²⁺ binding sitePresentPresentPresentEssential for catalytic activity
Flap domainModifiedPresentPresentSubstrate recognition and ABA receptor interaction
SnRK2 interaction surfacePresentPresentPresentDetermines specificity for SnRK2 substrates
ABA receptor binding pocketPresentPresentPresentCritical for ABA-mediated inhibition

What are the optimal conditions for expressing and purifying active recombinant Os03g0292100?

Obtaining high-quality recombinant protein is crucial for biochemical and structural studies. Based on experience with similar phosphatases:

  • Bacterial expression system optimization:

    • Test multiple expression vectors (pET, pGEX, pMAL) to find optimal fusion tag (His, GST, MBP)

    • Optimize expression conditions: IPTG concentration (0.1-1.0 mM), temperature (16°C, 25°C, 37°C), and duration (4h vs. overnight)

    • Consider codon optimization for E. coli expression

  • Purification strategy:

    • Implement a two-step purification protocol (affinity chromatography followed by size exclusion)

    • Include phosphatase inhibitors in all buffers except final storage buffer

    • Test multiple buffer compositions for optimal stability and activity (pH range 6.5-8.0, various salt concentrations)

  • Activity validation:

    • Measure phosphatase activity using generic substrates (p-nitrophenyl phosphate)

    • Perform enzymatic assays with physiological substrates (phosphorylated SnRK2 proteins)

    • Determine kinetic parameters (Km, Vmax, kcat) under various conditions

How do mutations in Os03g0292100 affect ABA sensitivity and stress tolerance in rice?

To investigate the functional significance of Os03g0292100 in planta:

  • Generate knockout/knockdown lines using CRISPR/Cas9 or RNAi approaches

  • Create overexpression lines using the maize ubiquitin promoter

  • Perform comprehensive phenotypic analysis:

    • Measure ABA sensitivity in seed germination and root growth assays

    • Assess drought, salt, and cold tolerance at different developmental stages

    • Quantify physiological parameters (water loss rate, electrolyte leakage, proline content)

  • Molecular analysis:

    • Monitor phosphorylation status of known SnRK2 substrates

    • Analyze expression of ABA-responsive genes

    • Perform RNA-seq to identify genome-wide transcriptional changes

Preliminary data from similar PP2C mutants suggests the following patterns might be observed:

GenotypeABA SensitivityDrought ToleranceSalt ToleranceCold Tolerance
Wild-typeModerateModerateModerateModerate
os03g0292100 knockoutIncreasedEnhancedEnhancedEnhanced
Os03g0292100 overexpressionDecreasedReducedReducedReduced

How does Os03g0292100 interact with the broader ABA signaling network in rice?

Understanding the position of Os03g0292100 within the complex ABA signaling network requires integrative approaches:

  • Perform yeast two-hybrid (Y2H) and co-immunoprecipitation (Co-IP) screens to identify novel interaction partners beyond the canonical ABA pathway components

  • Use bimolecular fluorescence complementation (BiFC) to confirm interactions in planta and determine their subcellular context

  • Apply phosphoproteomic approaches to identify substrates of Os03g0292100:

    • Compare phosphoproteomes of wild-type and os03g0292100 mutant plants

    • Perform in vitro dephosphorylation assays using recombinant Os03g0292100 and protein extracts

  • Integrate genetic approaches by creating double and triple mutants with other ABA signaling components

Why might recombinant Os03g0292100 show low enzymatic activity in vitro?

Several factors can contribute to low activity of recombinant PP2C proteins:

  • Protein folding issues:

    • Try alternative expression systems (yeast, insect cells)

    • Test different fusion tags and their position (N- vs. C-terminal)

    • Include molecular chaperones during expression (co-express with GroEL/GroES)

  • Cofactor requirements:

    • Ensure sufficient Mg²⁺ or Mn²⁺ in reaction buffers (1-5 mM)

    • Test different metal ions and concentrations

    • Consider the presence of inhibitory ions in buffers (EDTA should be avoided)

  • Storage and stability:

    • Optimize protein storage conditions (glycerol concentration, temperature)

    • Test activity immediately after purification

    • Consider adding stabilizing agents (DTT, β-mercaptoethanol)

  • Substrate specificity:

    • Generic substrates may not be ideal for this specific PP2C

    • Try physiological substrates (phosphorylated SnRK2 proteins)

    • Consider substrate preparation methods (in vitro vs. in vivo phosphorylation)

How can contradictory results between in vitro and in vivo studies of Os03g0292100 be reconciled?

Discrepancies between in vitro biochemical and in vivo functional studies are common and can be addressed systematically:

  • Evaluate expression levels:

    • Confirm that transgenic lines express the protein at physiological levels

    • Check for potential silencing effects or compensatory mechanisms

  • Consider protein modifications:

    • Investigate post-translational modifications present in vivo but absent in vitro

    • Examine the effect of interacting proteins on activity

  • Employ complementary approaches:

    • Use phosphatase-dead mutants (e.g., D to A mutation in the catalytic site) as controls

    • Perform domain swap experiments to identify regions responsible for in vivo function

    • Develop assays that bridge in vitro and in vivo conditions (e.g., semi-in vitro assays using plant extracts)

  • Examine temporal and spatial regulation:

    • Consider developmental stages and tissue-specific effects

    • Investigate stimulus-dependent activation or inhibition

How might synthetic biology approaches be utilized to engineer Os03g0292100 for enhanced stress resilience in crops?

Engineering PP2C proteins offers potential for improving stress tolerance in crops:

  • Structure-guided protein engineering:

    • Introduce point mutations to modulate ABA sensitivity

    • Design chimeric proteins combining domains from different PP2Cs

    • Create switchable variants responsive to exogenous stimuli

  • Promoter engineering:

    • Develop stress-inducible or tissue-specific expression systems

    • Create synthetic promoters with optimized expression patterns

    • Implement feedback-regulated expression systems

  • Protein interaction engineering:

    • Modify surfaces involved in receptor or kinase interactions

    • Engineer altered substrate specificity

    • Design variants with modified sensitivity to ABA

  • Testing and validation:

    • Assess engineered variants in model systems before crop implementation

    • Evaluate potential pleiotropic effects on growth and development

    • Perform field trials under various environmental conditions

What is the evolutionary significance of Os03g0292100 compared to PP2Cs in other plant species?

Understanding the evolutionary context of Os03g0292100 can provide insights into its specialized functions:

  • Phylogenetic analysis:

    • Conduct comprehensive phylogenetic analyses comparing rice PP2Cs with those from other monocots, dicots, and lower plants

    • Identify clade-specific sequence features using conservation analysis

    • Examine synteny and gene duplication patterns

  • Functional comparative studies:

    • Perform complementation experiments using os03g0292100 mutants and orthologs from other species

    • Compare biochemical properties of recombinant proteins from different species

    • Investigate species-specific interaction partners

  • Adaptive evolution analysis:

    • Calculate Ka/Ks ratios to identify sites under positive selection

    • Correlate sequence variations with habitat-specific adaptive traits

    • Compare properties of PP2Cs from stress-tolerant and stress-sensitive species

How can multi-omics approaches help elucidate the broader biological functions of Os03g0292100?

Integrating multiple omics technologies provides comprehensive understanding of PP2C function:

  • Multi-omics experimental design:

    • Generate and compare transcriptomes, proteomes, phosphoproteomes, and metabolomes of wild-type and os03g0292100 mutant plants

    • Sample at multiple time points after stress application

    • Include different tissues and developmental stages

  • Data integration strategies:

    • Apply network analysis to identify functional modules affected by Os03g0292100

    • Use causal network inference to distinguish direct and indirect effects

    • Implement machine learning approaches to predict phenotypes from molecular patterns

  • Validation experiments:

    • Test predictions using targeted genetic and biochemical approaches

    • Create reporter systems to monitor signaling outputs in real-time

    • Develop mathematical models to predict system behavior under various conditions

A typical multi-omics experimental workflow might include:

Omics LayerTechniqueKey Information Provided
TranscriptomicsRNA-seqGlobal gene expression changes
ProteomicsLC-MS/MSProtein abundance changes
PhosphoproteomicsTiO₂ enrichment + LC-MS/MSChanges in protein phosphorylation status
MetabolomicsGC-MS, LC-MSMetabolic adjustments
PhenomicsHigh-throughput phenotypingGrowth and stress response parameters
InteractomicsAP-MS, Y2HProtein-protein interaction networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.