Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 5 (Os01g0552300, LOC_Os01g37130)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os01g0552300; LOC_Os01g37130; OSJNBa0066C06.19; Probable protein phosphatase 2C 5; OsPP2C05
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0552300
Target Protein Sequence
MALLSPRVPRLPLASASAAGAGLRCCVSGGRAGSAAWCHASAAGSVASSSSELEAIRWGT AKLQGARDEMEDEVVLRPGSLLDGFSFAAVFDGHAGFSAVEFLRDELYKECAAALDGGAV LSTKNLDAITDSIQRAFATVDANLSTWLEQMDKEDESGATATAMFLRNDVLVVSHIGDSC LQVVSRGGRPQAVTNFHRPYGNKKASLEEVKRIRAAGGWIVDGRICGEISVSRAFGDIRF KTRKNEMLVKGVKEGRWTEKFISRINFKGDLIVSSPDVSLVELGPDVEFVLLATDGLWDY IKSSEAVALVRDQLRQHGDVQVACEALGQIALDRRSQDNISIVIADLGRTNWKELPAQRP NLFLELTQAVATVGAVSLGIYISSLLALQ
Uniprot No.

Target Background

Database Links
Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the biological classification and functional role of Protein Phosphatase 2C 5 in rice?

Protein Phosphatase 2C 5 (OsPP2C05) is a member of the serine/threonine phosphatase family in rice. It belongs to the larger PP2C class, which represents the largest phosphatase group in plants. The gene is identified by two key identifiers: Os01g0552300 (genome annotation) and LOC_Os01g37130 (locus ID) .

PP2Cs play crucial roles in signal transduction pathways, particularly in stress responses and developmental processes. They function by removing phosphate groups from phosphorylated serine and threonine residues in target proteins, thereby regulating their activity. In plants, these enzymes are especially important in abscisic acid (ABA) signaling and abiotic stress tolerance mechanisms .

How should recombinant rice PP2C5 be stored and handled in laboratory settings?

For optimal stability and activity of recombinant rice PP2C5, the following storage and handling protocols are recommended:

  • Storage conditions: Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% is recommended as default)

    • Aliquot for long-term storage at -20°C/-80°C

  • Working conditions: For short-term use, working aliquots can be stored at 4°C for up to one week .

  • Stability considerations: Repeated freezing and thawing significantly reduces protein activity and should be avoided .

What expression systems are used for producing recombinant rice PP2C5?

The most common expression system for rice PP2C5 is E. coli, which allows for high yield production of the recombinant protein. The expression construct typically includes:

  • Full-length coding sequence (amino acids 1-389)

  • N-terminal His-tag for purification

  • Vector with strong inducible promoter (e.g., T7)

Alternative expression systems include:

  • Yeast expression systems

  • Baculovirus-insect cell systems

  • Mammalian cell expression systems

Each system offers different advantages regarding post-translational modifications, protein folding, and functional activity. The selection of an appropriate expression system depends on the specific research needs and downstream applications.

How does rice PP2C5 relate to other members of the PP2C family in rice?

Rice contains a significantly larger PP2C gene family compared to Arabidopsis, with approximately 90 PP2C genes identified in rice versus 80 in Arabidopsis . OsPP2C05 (LOC_Os01g37130) is one of these members, with specific phylogenetic relationships to other PP2Cs.

Comparative overview of selected rice PP2C family members:

PP2C MemberLocus IDGenome AnnotationKey Features/Functions
OsPP2C05LOC_Os01g37130Os01g0552300Subject of this FAQ
OsPP2C08LOC_Os01g46760Os01g0656200Probable protein phosphatase 2C 8
OsPP2C10LOC_Os02g05630Os02g0149800-
OsPP2C16LOC_Os02g38580Os02g0598400-
OsPP2C31LOC_Os03g16760Os03g0275100-

The extensive number of PP2C genes in rice suggests functional diversification and specialization in various signaling pathways .

What is known about the expression patterns of rice PP2C5 during development and stress conditions?

Expression analysis of rice PP2C genes, including PP2C5, has revealed distinct patterns during development and in response to various stresses. While specific data for PP2C5 is limited in the provided search results, studies on rice PP2Cs as a group have shown:

  • Developmental regulation: Many PP2Cs show tissue-specific expression patterns, suggesting roles in specific developmental processes.

  • Stress responsiveness: Several rice PP2Cs are transcriptionally regulated by abiotic stresses such as drought, salt, and cold .

  • Hormone responsiveness: Many PP2Cs are induced by abscisic acid (ABA), consistent with their role in ABA signaling pathways .

For comprehensive expression data, researchers should consult rice gene expression databases or conduct tissue-specific and stress-specific qRT-PCR analyses.

What experimental design approaches optimize the expression and purification of functional recombinant rice PP2C5?

Optimizing the expression and purification of functional recombinant rice PP2C5 requires a systematic experimental design approach. Based on successful recombinant protein expression studies , the following factorial design can be implemented:

Key variables to optimize:

  • Induction parameters:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (15-37°C)

    • Induction duration (2-24 hours)

  • Media composition:

    • Base media (LB, TB, 2YT)

    • Supplements (glucose, glycerol)

    • Salt concentration

  • Cell density at induction (OD600 0.4-1.0)

Recommended optimized conditions based on similar proteins:

  • Growth until OD600 of 0.8

  • Induction with 0.1 mM IPTG

  • Expression for 4 hours at 25°C

  • Media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

These conditions should be validated through a systematic 2^n factorial design experiment to identify the optimal combination for maximum soluble protein yield. The functional activity should be assessed using phosphatase activity assays to ensure that the recombinant protein is properly folded and active.

What methodologies are most effective for characterizing the catalytic activity of rice PP2C5?

Characterizing the catalytic activity of rice PP2C5 requires multiple complementary approaches:

  • In vitro phosphatase assays:

    • Substrate: p-nitrophenyl phosphate (pNPP) for general phosphatase activity

    • Phosphopeptide substrates for specificity studies

    • Radiolabeled substrates for highly sensitive detection

  • Kinetic analysis:

    • Determination of Km and Vmax values

    • Effects of divalent cations (Mg²⁺, Mn²⁺)

    • pH and temperature optima

  • Inhibitor studies:

    • Sensitivity to okadaic acid (typically resistant)

    • Response to ABA and PYL/RCAR proteins

    • Metal chelators (EDTA, EGTA)

  • Site-directed mutagenesis:

    • Mutation of conserved catalytic residues

    • Structure-function relationship studies

The appropriate methodology should be selected based on the specific research question, available equipment, and required sensitivity.

How can functional genomics approaches be applied to study the physiological roles of rice PP2C5 in planta?

To elucidate the physiological functions of rice PP2C5 in planta, several complementary functional genomics approaches can be employed:

  • Reverse genetics:

    • CRISPR/Cas9-mediated gene knockout or editing

    • RNAi-mediated gene silencing

    • T-DNA insertion mutants (if available)

  • Overexpression studies:

    • Constitutive overexpression under strong promoters

    • Tissue-specific or inducible overexpression

    • Heterologous expression in Arabidopsis for comparative analysis

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Bimolecular fluorescence complementation (BiFC)

  • Transcriptome analysis:

    • RNA-seq of knockout/overexpression lines

    • Comparison of wild-type and mutant responses to stresses

  • Phenotypic analysis:

    • Stress tolerance assessments (drought, salt, cold)

    • Developmental phenotypes

    • ABA sensitivity tests (germination, root growth, stomatal closure)

Studies with other PP2Cs have shown that overexpression in Arabidopsis can lead to ABA insensitivity and enhanced abiotic stress tolerance , suggesting similar approaches may be valuable for rice PP2C5.

What are the current hypotheses regarding the role of rice PP2C5 in stress signaling networks?

Based on studies of PP2C family members in rice and Arabidopsis, several hypotheses regarding rice PP2C5's role in stress signaling can be formulated:

  • Negative regulation of ABA signaling:

    • PP2C5 may function as a negative regulator of ABA signaling by dephosphorylating and inactivating SnRK2 kinases

    • Under stress conditions, ABA accumulation could lead to the formation of ABA-PYL/RCAR-PP2C complexes, inhibiting PP2C activity and allowing SnRK2 activation

  • Integration of multiple stress signals:

    • Beyond ABA, PP2C5 might participate in multiple stress signaling pathways, integrating responses to drought, salt, and temperature stresses

  • Crosstalk with other hormonal pathways:

    • Potential involvement in crosstalk between ABA and other hormone signaling pathways (auxin, ethylene, jasmonic acid)

  • Developmental regulation:

    • Possible roles in normal growth and developmental processes beyond stress responses

Current evidence from rice PP2C studies suggests these enzymes can function through both ABA-dependent and ABA-independent pathways to regulate stress responses . Further research specifically targeting rice PP2C5 is needed to validate these hypotheses.

How does post-translational regulation affect rice PP2C5 function and activity?

Post-translational modifications (PTMs) likely play crucial roles in regulating rice PP2C5 function, although specific data for this particular protein is limited. Based on studies of other PP2Cs, the following regulatory mechanisms can be hypothesized:

  • Phosphorylation:

    • Potential phosphorylation sites could modulate activity or protein-protein interactions

    • May create feedback regulation loops within signaling pathways

  • Ubiquitination and protein turnover:

    • Regulation of protein stability and degradation

    • Stress-induced changes in protein half-life

  • Protein-protein interactions:

    • Interaction with ABA receptors (PYL/RCAR proteins)

    • Formation of multiprotein signaling complexes

    • Sequestration by scaffold proteins

  • Subcellular localization changes:

    • Stress-induced changes in localization

    • Compartmentalization to regulate access to substrates

Methodologies to study these PTMs include mass spectrometry-based proteomics, in vitro modification assays, and the use of PTM-specific antibodies. Investigating these regulatory mechanisms could provide valuable insights into how rice PP2C5 activity is fine-tuned during stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.