Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 60 (Os06g0717800, LOC_Os06g50380)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
Os06g0717800; LOC_Os06g50380; OJ1540_H01.4; OsJ_22677; P0541C02.17; Probable protein phosphatase 2C 60; OsPP2C60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os06g0717800
Target Protein Sequence
MIVTLMNLLRACWRPSSNQHARAGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE DQCQIESGPLSFLDSGPYGTFVGVYDGHGGPETACYINDHLFHHLKRFASEQNSISADVL KKAYEATEDGFFSVVTKQWPVKPQIAAVGSCCLVGVICGGILYVANVGDSRVVLGRHVKA TGEVLAVQLSAEHNVSIESVRKELQSMHPEDRHIVVLKHNVWRVKGLIQVCRSIGDAYLK RSEFNREPLYAKFRLREPFHKPILSSEPSISVQPLQPHDQFLIFASDGLWEHLTNQEAVD IVHSSPRNGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVFLDSSLV SRASTYRGPSVSLRGGGVNLRSNTLAPYASQM
Uniprot No.

Target Background

Database Links

KEGG: osa:4342084

STRING: 39947.LOC_Os06g50380.1

UniGene: Os.8512

Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should Recombinant OsPP2C60 be properly stored and handled for experimental use?

For optimal stability and activity, Recombinant OsPP2C60 should be stored at -20°C in a Tris-based buffer with 50% glycerol. For extended storage periods, conserving the protein at -20°C or -80°C is recommended. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of enzymatic activity .

Methodology for handling includes:

  • Thaw frozen stock slowly on ice

  • Prepare working aliquots in smaller volumes to minimize freeze-thaw cycles

  • Use sterile technique when handling protein solutions

  • Return unused protein to appropriate storage temperature promptly

  • Monitor activity periodically to ensure protein stability

What are the key variables to consider when designing experiments with OsPP2C60?

When designing experiments with OsPP2C60, researchers should carefully define both independent and dependent variables to ensure methodologically sound results. The following table outlines essential variables to consider:

Variable TypeExamples for OsPP2C60 ExperimentsMeasurement Approach
Independent VariablesProtein concentration, Substrate concentration, Incubation time, pH, Temperature, Presence of activators/inhibitorsPrecisely controlled experimental conditions with appropriate ranges determined through pilot studies
Dependent VariablesEnzymatic activity, Substrate dephosphorylation rate, Conformational changes, Protein-protein interactionsSpectrophotometric assays, Radioactive assays, Western blotting, Mass spectrometry
Extraneous VariablesBuffer composition, Sample purity, Storage conditions, Experimental equipment calibrationStandardized protocols, Control experiments, Equipment validation

When establishing your experimental design, follow these methodological steps:

  • Define specific research questions based on the role of OsPP2C60

  • Formulate testable hypotheses regarding protein function

  • Determine appropriate experimental treatments and controls

  • Select between-subjects or within-subjects design as appropriate

  • Plan precise measurement techniques for dependent variables

How can I validate the activity of recombinant OsPP2C60 in vitro?

Validating OsPP2C60 activity requires a multi-step methodological approach:

  • Phosphatase Activity Assay: Use artificial substrates like p-nitrophenyl phosphate (pNPP) or 4-methylumbelliferyl phosphate (4-MUP) to measure general phosphatase activity. The reaction rate can be monitored by spectrophotometric detection of the released chromogenic or fluorogenic product.

  • Substrate Specificity Assay: Test physiologically relevant phosphorylated proteins or peptides as substrates. Phosphorylated proteins involved in ABA signaling pathways would be particularly relevant, as PP2C family members are known to participate in these pathways .

  • Kinetic Analysis: Determine kinetic parameters such as Km and Vmax by varying substrate concentrations. The data should be analyzed using Michaelis-Menten or Lineweaver-Burk plots.

  • Inhibitor Sensitivity: Test the effect of known PP2C inhibitors (such as okadaic acid or calyculin A) on enzyme activity to confirm the catalytic classification.

  • Divalent Cation Dependence: Assess activity in the presence of different concentrations of Mg²⁺ or Mn²⁺, as PP2Cs typically require these metal ions for activity.

The validation should include positive controls (commercial phosphatases with known activity) and negative controls (heat-inactivated enzyme or reactions without enzyme).

How does OsPP2C60 relate to other PP2C family members in rice and other plant species?

OsPP2C60 is one of 78 genes encoding 111 putative PP2C proteins identified in the rice genome. The PP2C family in rice shows remarkable diversity and has been phylogenetically classified into distinct subfamilies based on sequence similarity and domain organization .

Comparative analysis shows:

  • Family Size: Rice contains 78 PP2C genes encoding 111 putative proteins, while Arabidopsis has 80 genes encoding 109 putative proteins with PP2C domains. This similar number suggests conservation of this gene family between monocots and dicots .

  • Evolutionary Relationships: Phylogenetic analyses of rice and Arabidopsis PP2C proteins have revealed both shared and specific subfamilies, suggesting that while core functions are conserved, species-specific adaptations have evolved.

  • Structural Features: Analysis of gene structure and protein motifs shows characteristic patterns within each subfamily, with specific motifs outside the PP2C catalytic domain that may confer specialized functions.

  • Gene Duplication Events: The expansion of the PP2C family in rice and Arabidopsis has been traced to gene duplication events, which have contributed to functional diversification.

To properly place OsPP2C60 within this evolutionary context, researchers should conduct their own phylogenetic analysis using current bioinformatics tools such as MEGA, PHYLIP, or MrBayes, and reference comprehensive PP2C family analyses.

What signaling pathways is OsPP2C60 likely involved in, based on comparative genomics?

Based on comparative genomic analyses of PP2C family members, OsPP2C60 is likely involved in specific signaling pathways. While the exact pathways for OsPP2C60 need further experimental validation, insights from the PP2C family suggest several possibilities:

  • ABA Signaling: Many PP2C proteins, particularly from subfamily A, are involved in abscisic acid (ABA) signaling. They act as negative regulators by dephosphorylating and inactivating SnRK2 protein kinases in the absence of ABA .

  • Stress Response Pathways: PP2Cs often function in stress response mechanisms, particularly drought, salt, and cold stress tolerance. They may modulate MAPK cascades that are activated during stress conditions.

  • Immune Response Regulation: Some PP2C members participate in plant immunity regulation, as evidenced by the activation of immune responses in rice by certain proteins. For example, some proteins can trigger ROS production and callose deposition, key components of plant defense mechanisms .

  • Developmental Processes: PP2Cs may also regulate developmental processes through hormone-mediated signaling pathways.

To determine the specific pathways involving OsPP2C60, researchers should employ:

  • Yeast two-hybrid screening to identify protein interaction partners

  • Co-immunoprecipitation to validate protein-protein interactions in vivo

  • Phosphoproteomic analysis to identify substrates

  • Expression analysis under different hormonal treatments and stress conditions

  • Genetic approaches such as gene knockout or overexpression studies followed by phenotypic analysis

How can CRISPR-Cas9 gene editing be optimized for studying OsPP2C60 function in rice?

Optimizing CRISPR-Cas9 gene editing for OsPP2C60 functional studies requires careful methodological planning:

  • Guide RNA Design:

    • Design multiple guide RNAs targeting the OsPP2C60 gene (Os06g0717800/LOC_Os06g50380)

    • Target conserved regions of the catalytic domain to ensure loss of function

    • Verify guide RNA specificity using tools like CRISPR-P 2.0 to minimize off-target effects

    • Consider targeting different exons to create various mutation types

  • Vector Construction:

    • Use rice-optimized Cas9 with appropriate promoters (e.g., maize ubiquitin promoter)

    • Include selectable markers for transgenic plant selection

    • Consider using a dual gRNA approach for precise deletions

  • Rice Transformation Protocol:

    • Transform embryogenic calli derived from immature embryos

    • Use Agrobacterium-mediated transformation with strain EHA105

    • Optimize hygromycin concentration for selection based on rice variety

    • Ensure proper callus induction and regeneration conditions

  • Mutation Verification:

    • Screen transformants using PCR-based methods

    • Confirm mutations by Sanger sequencing

    • Verify protein loss using immunoblotting with OsPP2C60-specific antibodies

    • Check for off-target mutations in predicted sites

  • Phenotypic Analysis Plan:

    • Examine ABA sensitivity in germination and seedling growth

    • Assess drought, salt, and cold stress tolerance

    • Analyze disease resistance phenotypes

    • Evaluate developmental parameters under normal and stress conditions

This comprehensive approach will enable precise functional characterization of OsPP2C60 while minimizing experimental artifacts.

What transcriptomic approaches would be most effective for identifying genes regulated by OsPP2C60?

To effectively identify genes regulated by OsPP2C60, a multi-layered transcriptomic approach is recommended:

  • RNA-Seq Analysis:

    • Compare transcriptomes of OsPP2C60 knockout/knockdown lines with wild-type plants

    • Include multiple time points after specific treatments (e.g., ABA, drought, pathogen exposure)

    • Use at least 3-4 biological replicates per condition

    • Implement stringent quality control including RNA integrity number (RIN) > 8

    • Apply robust statistical analysis with FDR correction for multiple testing

  • Time-Course Expression Profiling:

    • Monitor expression changes at several time points post-treatment

    • This helps distinguish primary from secondary effects of OsPP2C60 regulation

    • Construct gene regulatory networks using algorithms like WGCNA

  • Tissue-Specific Transcriptomics:

    • Examine different tissues to identify tissue-specific regulatory roles

    • Consider laser-capture microdissection for specific cell types

    • Compare with publicly available tissue-specific expression datasets

  • Integration with ChIP-Seq or DAP-Seq:

    • Identify direct targets by determining binding sites of transcription factors regulated by OsPP2C60

    • Use epitope-tagged OsPP2C60 interacting partners for chromatin immunoprecipitation

  • Validation Methods:

    • qRT-PCR validation of key differentially expressed genes

    • Promoter-reporter assays to confirm transcriptional regulation

    • Protein-protein interaction assays to identify physical interactions between OsPP2C60 and transcriptional machinery

This comprehensive approach will help distinguish direct and indirect regulatory effects of OsPP2C60, providing a more complete understanding of its role in transcriptional networks.

How can I resolve issues with low activity of recombinant OsPP2C60 in phosphatase assays?

When encountering low activity of recombinant OsPP2C60 in phosphatase assays, follow this methodological troubleshooting approach:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE

    • Check for proper folding using circular dichroism

    • Assess aggregation state with dynamic light scattering

    • Consider native PAGE to verify homogeneity

  • Buffer Optimization:

    • Test different pH ranges (typically pH 6.5-8.0 for PP2Cs)

    • Optimize divalent cation concentration (Mg²⁺ or Mn²⁺)

    • Evaluate different buffer systems (HEPES, Tris, phosphate)

    • Add reducing agents (DTT or β-mercaptoethanol) to maintain cysteine residues in reduced state

  • Assay Conditions Refinement:

    • Vary substrate concentration to determine optimal range

    • Adjust enzyme concentration

    • Test different incubation times and temperatures

    • Screen for potential activators specific to PP2C family

  • Expression System Considerations:

    • Re-evaluate the expression system (bacterial, insect, plant)

    • Consider codon optimization for expression host

    • Test different fusion tags that may enhance solubility

    • Optimize induction conditions for protein expression

  • Validation Experiments:

    • Use known PP2C substrates as positive controls

    • Compare activity to commercially available PP2C proteins

    • Test multiple substrate types (synthetic vs. natural)

The following table summarizes key parameters to optimize:

ParameterStandard RangeOptimization Approach
pH6.5-8.00.5 unit increments
[Mg²⁺]5-20 mM5 mM increments
Temperature25-37°C5°C increments
Reducing Agent1-10 mM DTT2-fold dilution series
Enzyme Concentration10-100 nM2-fold dilution series
Substrate Concentration10 μM-1 mMLog-scale dilution series

What strategies can address potential specificity issues when studying OsPP2C60 interactions with target proteins?

Addressing specificity issues in OsPP2C60 interaction studies requires rigorous methodology:

  • Controls for Interaction Specificity:

    • Include structurally similar PP2C family members as specificity controls

    • Use catalytically inactive OsPP2C60 mutants (e.g., mutations in metal-coordinating residues)

    • Test interactions with known non-substrates as negative controls

    • Include known PP2C substrates as positive controls

  • Complementary Interaction Detection Methods:

    • Combine multiple approaches such as:

      • Yeast two-hybrid (Y2H)

      • Bimolecular fluorescence complementation (BiFC)

      • Co-immunoprecipitation (Co-IP)

      • Surface plasmon resonance (SPR) for quantitative binding parameters

      • Microscale thermophoresis (MST) for solution-based interaction analysis

  • Domain Mapping:

    • Create truncation constructs to identify specific interaction domains

    • Generate chimeric proteins with domains from related PP2Cs

    • Perform alanine scanning mutagenesis on key residues

  • Competition Assays:

    • Use unlabeled potential interactors in competition assays

    • Determine relative binding affinities

    • Assess displacement of known interactors

  • In Vivo Validation:

    • Confirm interactions in plant cells using FRET or FLIM

    • Perform genetic studies (double mutants analysis)

    • Use phosphoproteomics to identify differential phosphorylation

This systematic approach minimizes false positives and provides strong evidence for biologically relevant interactions with OsPP2C60.

How should contradictory results in OsPP2C60 functional studies be analyzed and resolved?

When faced with contradictory results in OsPP2C60 functional studies, researchers should employ a structured analytical approach:

  • Systematic Comparison of Methodologies:

    • Create a detailed comparison table of experimental conditions across studies

    • Identify key differences in:

      • Protein preparation (expression system, purification method, tags)

      • Assay conditions (buffer, pH, temperature, ion concentrations)

      • Genetic background of plant materials

      • Experimental design and statistical approaches

  • Statistical Reanalysis:

    • Reanalyze raw data when available using standardized statistical methods

    • Consider meta-analysis approaches if multiple studies exist

    • Evaluate statistical power and sample sizes in conflicting studies

    • Assess whether appropriate controls were included

  • Biological Factors Consideration:

    • Evaluate potential developmental, tissue-specific, or stress-specific regulation

    • Consider post-translational modifications affecting OsPP2C60 function

    • Assess genetic background effects (different rice varieties)

    • Examine environmental conditions during experiments

  • Independent Validation Strategies:

    • Design experiments that directly address contradictions

    • Use multiple approaches to test the same hypothesis

    • Collaborate with other laboratories for independent replication

    • Consider blind experimental design to minimize bias

  • Reconciliation Framework:

    • Develop models that could explain seemingly contradictory results

    • Test predictions from these models with new experiments

    • Consider that contradictions may reflect different aspects of a complex biological system

This methodological approach not only helps resolve contradictions but may lead to deeper insights into the context-dependent functions of OsPP2C60.

What bioinformatic pipelines are recommended for analyzing PP2C60 structural features and predicting functional domains?

For comprehensive analysis of OsPP2C60 structural features and functional domain prediction, a multi-step bioinformatic pipeline is recommended:

  • Primary Sequence Analysis:

    • Use tools like ProtParam (ExPASy) for basic physicochemical properties

    • Apply multiple sequence alignment (MUSCLE, CLUSTALW) with other PP2C family members

    • Identify conserved residues and motifs specific to PP2C subfamilies

    • Analyze sequence for post-translational modification sites (NetPhos, GPS)

  • Secondary Structure Prediction:

    • Implement consensus predictions from multiple algorithms:

      • PSIPRED

      • JPred

      • GOR

    • Compare predictions to known PP2C structures

    • Identify potential disordered regions using IUPred or PONDR

  • Tertiary Structure Modeling:

    • Perform homology modeling using:

      • SWISS-MODEL

      • Phyre2

      • I-TASSER

    • Validate models with ProCheck, VERIFY3D, and MolProbity

    • Refine models with molecular dynamics simulations

    • Compare to crystallized PP2C structures (e.g., HAB1, ABI1)

  • Functional Domain Prediction:

    • Use integrated domain prediction platforms:

      • InterProScan

      • SMART

      • Pfam

    • Identify catalytic residues and substrate binding regions

    • Predict protein-protein interaction interfaces using SPPIDER or meta-PPISP

    • Analyze surface electrostatics with APBS

  • Evolutionary Conservation Analysis:

    • Apply ConSurf or Rate4Site for evolutionary conservation mapping

    • Identify functionally important residues based on conservation patterns

    • Compare rice-specific features with other plant PP2Cs

The results from this comprehensive pipeline should be integrated into a structural-functional model that guides experimental design for validation of key predictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.