Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 72 (Os10g0544900, LOC_Os10g39780)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os10g0544900; LOC_Os10g39780; OsJ_026955; OsJ_28079; OSJNBa0001O14.1; Probable protein phosphatase 2C 72; OsPP2C72
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os10g0544900
Target Protein Sequence
MLSAAMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL LEDHSQVESGPLSTTDPNLQGTLVGVYDGHGGPETARYINDHLFNHLRGFASEHKCMSAD VIRKAFRATEEGFFSVVSSQWSMRPQLAAVGSCCLVGVICAGNLYIANLGDSRAVLGRLV KGTGEVLAMQLSAEHNASFEEVRRELQAAHPDDPHIVVLKHNVWRVKGIIQITRSIGDVY LKKPEFNREPLHSKFRLQETFRRPLLSSEPAIVVHQLQTTDQFIIFASDGLWEHISNQEA VDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVFFDSN AITTANWSRPSVSLRGGGVTLPANSLAPFSVPT
Uniprot No.

Target Background

Database Links

KEGG: osa:4349275

STRING: 39947.LOC_Os10g39780.1

UniGene: Os.3095

Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the role of protein phosphatase 2C 72 (Os10g0544900) in signaling pathways of Oryza sativa?

Protein phosphatase 2C 72 (Os10g0544900) functions as a serine/threonine-specific phosphatase in rice signaling networks. Based on comparative studies with other type 2C protein phosphatases, Os10g0544900 likely plays crucial roles in dephosphorylating key components within mitogen-activated protein kinase (MAPK) cascades. Similar to other PP2Cs in rice, it may be involved in negative regulation of stress-activated signaling pathways.

Research indicates that type 2C protein phosphatases in rice function similarly to their homologs in other systems, where they modulate signaling by removing phosphate groups from activated kinases. For example, research on brassinosteroid (BR) signaling in rice has demonstrated that PP2Cs are involved in dephosphorylating components like OsGSK1 (Glycogen Synthase Kinase3-like 1, LOC_Os01g10840) and OsBZR1 (LOC_Os07g39220) . The dephosphorylation of these components is critical for proper signal transduction.

How is Os10g0544900 expression regulated during stress conditions?

Studies examining type 2C protein phosphatases in plants suggest that Os10g0544900 expression is likely regulated by various stress conditions. Drawing parallels from research on similar PP2Cs, expression analysis would typically be performed using quantitative real-time PCR (qRT-PCR) under different stress conditions.

For instance, comparable PP2Cs like MoPtc1 and MoPtc2 in Magnaporthe oryzae show differential expression under osmotic stress (NaCl and KCl) and ionic stress (CaCl₂), with the highest expression observed under calcium chloride exposure . This suggests that Os10g0544900 may similarly respond to ionic stressors, particularly calcium signaling pathways. Experimental validation of Os10g0544900 would require:

  • Subjecting rice plants to various stressors (drought, salinity, cold, heat, pathogen infection)

  • Harvesting tissues at multiple time points (0h, 3h, 12h, 24h, 48h)

  • Extracting total RNA using standard TRIzol protocol

  • Synthesizing cDNA and performing qRT-PCR with Os10g0544900-specific primers

  • Normalizing expression data against reference genes (e.g., OsActin, OsUbiquitin)

What are the optimal protocols for expressing and purifying recombinant Os10g0544900 protein?

Recombinant Os10g0544900 protein can be efficiently expressed and purified using several expression systems. Based on successful purification of similar PP2C proteins, the following protocol is recommended:

Expression System Options:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coli (BL21(DE3))High yield, cost-effectivePotential folding issues10-20 mg/L culture
Yeast (P. pastoris)Better folding, post-translational modificationsLower yield, longer process5-10 mg/L culture
BaculovirusExcellent for complex proteinsExpensive, time-consuming1-5 mg/L culture
Cell-free expressionRapid, avoids toxicity issuesExpensive, lower yieldVariable

Recommended Protocol for E. coli Expression:

  • Clone the full-length coding sequence of Os10g0544900 into pET28a vector with an N-terminal His-tag

  • Transform into BL21(DE3) cells and select on LB-kanamycin plates

  • Grow transformed cells in LB medium at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Induce protein expression with 0.5 mM IPTG at 18°C for 16-18 hours

  • Harvest cells by centrifugation at 5,000×g for 15 minutes at 4°C

  • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, 10% glycerol, 1 mM DTT, and protease inhibitor cocktail

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

This protocol typically yields ≥85% purity as determined by SDS-PAGE , sufficient for most biochemical and structural studies.

How can the phosphatase activity of recombinant Os10g0544900 be reliably measured?

Phosphatase activity of recombinant Os10g0544900 can be assessed using several complementary approaches:

Standard pNPP Assay:

  • Prepare reaction mixture containing 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT, and 5-10 mM pNPP (para-nitrophenyl phosphate)

  • Add 0.5-2 μg purified recombinant Os10g0544900

  • Incubate at 30°C for 30 minutes

  • Stop reaction with 0.5 M NaOH

  • Measure absorbance at 405 nm

  • Calculate specific activity as μmol pNP produced per minute per mg protein

Phosphopeptide-Based Assay:
For more physiologically relevant substrates, synthetic phosphopeptides corresponding to potential target sites can be used. Similar approaches with PP45 in rice demonstrated specificity for certain phosphopeptides :

  • Design synthetic phosphopeptides based on predicted Os10g0544900 substrates

  • Incubate 1-5 μg recombinant Os10g0544900 with 50-100 μM phosphopeptide in buffer containing 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT

  • Incubate at 30°C for 30 minutes

  • Quantify released phosphate using malachite green assay or mass spectrometry

Effect of Inhibitors and Activators:
To characterize regulatory mechanisms, activity should be tested in the presence of:

  • Divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)

  • Oxidizing agents (H₂O₂) to test redox sensitivity

  • Reducing agents (DTT, TCEP) to reverse potential oxidation effects

  • Specific PP2C inhibitors (okadaic acid, sanguinarine)

What structural domains are present in Os10g0544900 and how do they contribute to its function?

Os10g0544900 contains characteristic domains of the PP2C family. Based on structural analysis of related PP2Cs, the following domains and features are likely present:

Domain Architecture:

  • N-terminal region: May contain regulatory sequences or localization signals

  • Catalytic PP2C domain: Contains the signature motifs for metal coordination and phosphatase activity

  • Regulatory elements: Possible C-terminal extensions that mediate protein-protein interactions or regulate activity

Critical residues likely include conserved aspartic acid residues in the active site that coordinate metal ions (typically Mg²⁺ or Mn²⁺) essential for catalysis. The catalytic mechanism involves a metal-activated water molecule that acts as a nucleophile to attack the phosphate group.

How is Os10g0544900 activity regulated by post-translational modifications?

PP2C proteins, including Os10g0544900, are subject to several post-translational modifications that regulate their activity:

Oxidation-Reduction Regulation:
Research on similar PP2Cs suggests that Os10g0544900 might undergo oxidation of critical cysteine residues under oxidative stress conditions. For example, PP45 in rice forms dimers through disulfide bonds when treated with H₂O₂, resulting in significantly reduced phosphatase activity (only 20% of monomeric activity) . The phosphatase activity can be restored by reducing agents like DTT or TCEP.

Experimental approach to test this:

  • Incubate recombinant Os10g0544900 with 0.1 mM H₂O₂ for 30 minutes

  • Divide sample and treat one portion with reducing agents (1-10 mM DTT or TCEP)

  • Assess phosphatase activity using standard assays

  • Analyze protein state (monomer vs. dimer) using non-reducing SDS-PAGE and size exclusion chromatography

Phosphorylation:
Os10g0544900 itself may be regulated by phosphorylation. To identify potential phosphorylation sites:

  • Treat recombinant protein with various kinases in vitro

  • Analyze by mass spectrometry to identify phosphorylation sites

  • Generate phosphomimetic (S/T to D/E) and phospho-null (S/T to A) mutants

  • Compare activities of wild-type and mutant proteins

What role does Os10g0544900 play in brassinosteroid signaling in rice?

Os10g0544900, as a PP2C family member, likely participates in brassinosteroid (BR) signaling based on phosphoproteomic studies of BR responses in rice. While its specific role is not fully characterized, research on BR signaling in rice provides insights into potential functions:

BR signaling involves the dephosphorylation of key components like OsGSK1 and OsBZR1. In the presence of BR, OsGSK1 (a negative regulator similar to AtBIN2) is dephosphorylated, losing its kinase activity. Simultaneously, PP2A dephosphorylates OsBZR1, preventing its binding with 14-3-3 proteins and allowing it to remain in the nucleus where it can activate BR-responsive genes .

Os10g0544900 may function by:

  • Directly dephosphorylating OsGSK1 or OsBZR1

  • Regulating other kinases within the BR signaling pathway

  • Modulating BR-dependent gene expression through other transcription factors

To investigate Os10g0544900's role in BR signaling experimentally:

  • Generate Os10g0544900 knockout or overexpression rice lines

  • Assess BR sensitivity by measuring lamina joint angle, coleoptile elongation, and root growth

  • Analyze the phosphorylation status of known BR signaling components in these lines

  • Perform RNA-seq to identify differentially expressed genes under BR treatment

How does Os10g0544900 contribute to rice disease resistance and stress response mechanisms?

Based on studies of type 2C protein phosphatases in plant-pathogen interactions, Os10g0544900 may play important roles in rice immune responses. Research on related phosphatases suggests several potential mechanisms:

Pathogen Response Regulation:
Studies on MoPtc1 and MoPtc2 in the rice blast fungus (Magnaporthe oryzae) show that these phosphatases are significantly induced during pathogen-host interactions, particularly at 12 hours post-infection, suggesting important roles during appressorium development . By analogy, Os10g0544900 in rice may be involved in:

  • Regulating MAPK cascades that activate defense responses

  • Modulating salicylic acid or jasmonic acid signaling pathways

  • Controlling reactive oxygen species production during immune responses

Abiotic Stress Tolerance:
Os10g0544900 may also function in abiotic stress responses. Research on rice salinity tolerance has identified multiple genomic regions and candidate genes involved in salt stress adaptation . To investigate Os10g0544900's role in abiotic stress:

  • Analyze expression patterns under drought, salt, cold, and heat stress

  • Generate transgenic rice with altered Os10g0544900 expression

  • Evaluate stress tolerance phenotypes, including:

    • Relative water content

    • Electrolyte leakage

    • Proline and malondialdehyde content

    • Antioxidant enzyme activities

  • Perform phosphoproteomic analysis to identify differentially phosphorylated proteins

How does Os10g0544900 compare to other PP2C family members in Oryza sativa?

Rice contains multiple PP2C family members that differ in their structure, regulation, and function. A comparative analysis of Os10g0544900 with other rice PP2Cs would likely reveal:

Phylogenetic Relationship:
Os10g0544900 (probable protein phosphatase 2C 72) belongs to the broader PP2C family in rice. Similar to the classification system for Arabidopsis PP2Cs, rice PP2Cs can be grouped into several clades based on sequence similarity. The specific clade containing Os10g0544900 would determine its closest functionally related PP2Cs.

Expression Pattern Comparison:
To understand functional specialization, compare expression patterns of Os10g0544900 with other PP2Cs across:

  • Different tissues (roots, shoots, leaves, panicles)

  • Developmental stages (seedling, vegetative, reproductive)

  • Stress conditions (biotic and abiotic stressors)

Substrate Specificity:
Different PP2Cs may have overlapping yet distinct substrate preferences. To determine the unique and shared targets of Os10g0544900:

  • Perform in vitro dephosphorylation assays with potential substrates

  • Use phosphoproteomic approaches to identify differentially phosphorylated proteins in Os10g0544900 mutant lines

  • Conduct yeast two-hybrid or co-immunoprecipitation experiments to identify interacting partners

How conserved is Os10g0544900 across different rice subspecies and varieties?

Sequence Conservation Analysis:
Compare Os10g0544900 sequences from various rice subspecies and varieties:

  • Oryza sativa ssp. japonica

  • Oryza sativa ssp. indica

  • Oryza sativa ssp. javanica (tropical japonica)

  • Wild rice species (O. rufipogon, O. nivara)

Research on rice subspecies diversity shows significant genetic variation across varieties. For example, InDel markers developed for Oryza sativa ssp. javanica (tropical japonica rice) have revealed extensive phenotypic variations in important agronomic traits, including disease resistance .

Functional Impact of Variations:

  • Identify single nucleotide polymorphisms (SNPs) and insertions/deletions (InDels) in Os10g0544900 across rice varieties

  • Predict the impact of these variations on protein structure and function using bioinformatic tools

  • Correlate sequence variations with phenotypic differences in stress tolerance or disease resistance

  • Validate functional impacts through complementation studies in knockout lines

How can CRISPR-Cas9 gene editing be optimized for functional characterization of Os10g0544900?

CRISPR-Cas9 gene editing offers precise tools for functional characterization of Os10g0544900. An optimized protocol would include:

Guide RNA Design:

  • Select target sites within Os10g0544900 exons, preferably in the catalytic domain

  • Design 2-3 guide RNAs per target using tools like CRISPR-P or CHOPCHOP

  • Evaluate potential off-target effects using rice genome database

Recommended Methodology:

  • Clone guide RNAs into rice-optimized CRISPR-Cas9 vectors (e.g., pRGEB32)

  • Transform into rice calli using Agrobacterium-mediated transformation

  • Select transformed plants using hygromycin selection

  • Screen T0 plants for mutations using PCR-RE assay or Sanger sequencing

  • Confirm homozygous mutants in T1 generation

Validation and Phenotyping:

  • Verify gene knockout at protein level using western blot or phosphatase activity assays

  • Perform phenotypic characterization under normal and stress conditions

  • Complement mutant lines with wild-type or mutated (phosphatase-dead) Os10g0544900 to confirm specificity

Advanced Modifications:
For more sophisticated analysis, consider:

  • Base editing to introduce specific amino acid changes

  • Prime editing for precise sequence modifications

  • Inducible CRISPR systems for temporal control of editing

What are the best approaches for identifying in vivo substrates of Os10g0544900?

Identifying the physiological substrates of Os10g0544900 is crucial for understanding its biological functions. Several complementary approaches can be employed:

Phosphoproteomic Analysis:

  • Generate Os10g0544900 knockout and overexpression lines

  • Extract total proteins under normal and stress conditions

  • Enrich phosphopeptides using TiO₂ or IMAC (Immobilized Metal Affinity Chromatography)

  • Analyze by LC-MS/MS to identify differentially phosphorylated proteins

  • Validate candidates through in vitro dephosphorylation assays

Similar phosphoproteomic approaches have successfully identified 3,412 phosphosites on 3,179 phosphopeptides in rice, with 89.7% being phosphoserine, 9.9% phosphothreonine, and 0.4% phosphotyrosine . This demonstrates the feasibility of large-scale phosphopeptide identification in rice.

Protein-Protein Interaction Studies:

  • Perform yeast two-hybrid screening using Os10g0544900 as bait

  • Conduct co-immunoprecipitation followed by mass spectrometry

  • Use bimolecular fluorescence complementation (BiFC) to validate interactions in planta

  • Apply proximity-dependent biotin identification (BioID) to capture transient interactions

Substrate Trapping:
Develop catalytically inactive "substrate-trapping" mutants of Os10g0544900:

  • Identify and mutate catalytic residues based on conserved PP2C active sites

  • Express tagged substrate-trapping mutants in rice

  • Isolate stable enzyme-substrate complexes by immunoprecipitation

  • Identify trapped substrates by mass spectrometry

How can manipulation of Os10g0544900 expression be utilized to enhance stress tolerance in rice?

Based on the roles of PP2C proteins in stress signaling, modulation of Os10g0544900 expression or activity presents opportunities for developing stress-tolerant rice varieties:

Strategies for Genetic Modification:

  • Overexpression approach: Generate transgenic rice overexpressing Os10g0544900 under constitutive or stress-inducible promoters

  • RNA interference (RNAi): Develop lines with reduced Os10g0544900 expression using RNAi constructs

  • CRISPR-based transcriptional regulation: Apply CRISPR-dCas9 activation or repression systems to modulate expression without altering the gene sequence

  • Promoter modification: Engineer the native promoter to alter expression patterns under specific conditions

Evaluation of Stress Tolerance:
Assess modified lines for:

  • Drought tolerance: Measure relative water content, ABA sensitivity, stomatal conductance

  • Salt tolerance: Analyze Na⁺/K⁺ ratios, electrolyte leakage, growth parameters under saline conditions

  • Disease resistance: Challenge plants with rice pathogens and quantify disease progression

  • Agronomic performance: Evaluate yield components under both normal and stress conditions

Potential Trade-offs:
Consider possible negative effects of Os10g0544900 modification:

  • Growth-defense trade-offs affecting yield potential

  • Altered developmental timing or morphology

  • Unexpected effects on other signaling pathways

Research on salinity tolerance in rice has identified quantitative trait loci (QTLs) and candidate genes that could interact with PP2C-mediated pathways . Integration of Os10g0544900 modification with other known stress tolerance genes may provide synergistic effects.

What techniques are available for monitoring Os10g0544900 activity in planta?

Monitoring Os10g0544900 activity in living plants requires sophisticated approaches that can detect phosphatase activity with spatial and temporal resolution:

Phosphorylation-Specific Antibodies:

  • Develop antibodies against phosphorylated forms of known Os10g0544900 substrates

  • Use immunoblotting to track substrate phosphorylation status in different tissues and conditions

  • Apply immunohistochemistry to visualize spatial patterns of substrate phosphorylation

Fluorescent Biosensors:
Design FRET (Förster Resonance Energy Transfer)-based biosensors:

  • Construct sensors containing substrate peptides flanked by fluorescent proteins

  • Phosphorylation/dephosphorylation changes FRET efficiency

  • Express in plants to monitor Os10g0544900 activity in real-time

  • Use confocal microscopy to observe subcellular activity patterns

Genetic Reporters:

  • Identify transcriptional responses specifically regulated by Os10g0544900 activity

  • Create reporter constructs with these promoters driving luciferase or GFP expression

  • Monitor reporter activity as a proxy for Os10g0544900 function

Biochemical Analysis:

  • Extract proteins from different plant tissues under various conditions

  • Measure phosphatase activity using artificial substrates

  • Use phosphoproteomic analysis to quantify changes in substrate phosphorylation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.