Recombinant Oryza sativa subsp. japonica Probable protein phosphatase 2C 9 (Os01g0846300, LOC_Os01g62760)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Probable Protein Phosphatase 2C 9

Recombinant Oryza sativa subsp. japonica Probable Protein Phosphatase 2C 9, identified by the gene loci Os01g0846300 and LOC_Os01g62760, is a member of the Protein Phosphatase 2C (PP2C) family. PP2Cs are crucial enzymes involved in various signaling pathways in plants, including stress responses and developmental processes. This specific enzyme is part of the japonica subspecies of rice, which is one of the most widely cultivated rice varieties globally.

Function and Role in Plants

Protein Phosphatase 2C enzymes, including the Os01g0846300 variant, play significant roles in dephosphorylating proteins, which is essential for regulating cellular signaling pathways. In plants, PP2Cs are involved in responses to environmental stresses such as drought, salt, and cold. They also participate in hormonal signaling pathways, including those mediated by abscisic acid (ABA), which is crucial for stomatal closure and stress tolerance.

FunctionDescription
Stress ResponseInvolved in plant responses to drought, salt, and cold stress.
Hormonal SignalingParticipates in ABA signaling pathways, affecting stomatal closure and stress tolerance.
Developmental ProcessesMay influence plant growth and development through regulation of signaling pathways.

Recombinant Protein Production

Recombinant proteins like Os01g0846300 are produced using biotechnological methods, where the gene encoding the protein is inserted into a suitable host organism (e.g., bacteria or yeast) for expression. This allows for large-scale production of the protein for research purposes, such as studying its biochemical properties or potential applications in agriculture and biotechnology .

Applications and Future Directions

The recombinant Os01g0846300 protein could be used in various applications:

  • Stress Tolerance Studies: Investigating how this enzyme influences stress responses in rice could lead to strategies for improving crop resilience.

  • Agricultural Biotechnology: Understanding its role in signaling pathways might help in developing genetically modified crops with enhanced stress tolerance.

  • Basic Research: Studying its biochemical properties and interactions with other proteins can provide insights into plant signaling mechanisms.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
Os01g0846300; LOC_Os01g62760; OsJ_003961; OsJ_04060; P0446B05.26-1; P0446B05.26-2; P0446B05.26-3; Probable protein phosphatase 2C 9; OsPP2C09
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0846300
Target Protein Sequence
MAEICCEEAMSPPATATAAVAAAVSASAAAAVSSAIDRRRRRMEMRRIRIASDLELQAGE DGRPGKRQRLARTASGAPRPDEDSASERPSCGRTEEFPRYGVTAVCGRRREMEDAVSIRP DFLPASGKFHFYGVFDGHGCSHVATTCQDRMHEIVAEEHNKGASGEVAPWRDVMEKSFAR MDGEVGNRASTRSDDEPACPCEQQTPSRRDHAGSTAVVAVVSPTQVVVANAGDSRAVISR AGVPVALSVDHKPDRPDELERIEAAGGRVIYWDGARVLGVLAMSRAIGDGYLKPYVTSEP EVTVTERTDDDECLILASDGLWDVVTNEMACEVVRACFHNNGPPAPAARPSGVPSSAEAA ETENGGAASVKGISKAESSDKACSDAAMLLTKLALARRSADNVSVVVVDLRRGL
Uniprot No.

Target Background

Database Links
Protein Families
PP2C family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression patterns does OsPP2C09 show in different rice tissues and under various conditions?

OsPP2C09 exhibits a distinctive tissue-specific expression pattern, with significantly higher expression in roots than in shoots under normal conditions . When examining its expression profile across different developmental stages, OsPP2C09 shows expression in multiple tissues denoted as B (leaf), C (panicle), D (root), and E (seed/fruit) based on microarray data .

Under stress conditions, OsPP2C09 transcript levels are rapidly induced by:

  • Abscisic acid (ABA) treatment

  • Polyethylene glycol (PEG) treatment (osmotic stress)

  • Dehydration

Notably, the accumulation rate of OsPP2C09 transcripts in roots is more rapid and greater than that in shoots following these treatments . This differential expression pattern between roots and shoots may contribute to increasing the plant's root-to-shoot ratio under drought stress conditions, which is an adaptive response to water limitation.

How should recombinant OsPP2C09 protein be stored and handled for experimental use?

For optimal storage and handling of recombinant OsPP2C09 protein:

  • Storage buffer: Use Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Storage temperature: Store at -20°C for routine use; for extended storage, conserve at -20°C or -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it may affect protein activity

For phosphatase activity assays, the protein should be used in buffers containing either Mg²⁺ or Mn²⁺ ions, as PP2C phosphatases require these divalent cations for catalytic activity .

What is the role of OsPP2C09 in abscisic acid (ABA) signaling in rice?

OsPP2C09 functions as a negative regulatory factor in ABA signaling pathways in rice. Mechanistically, OsPP2C09:

  • Interacts directly with core components of ABA signaling, including ABA receptors (OsPYLs)

  • In the absence of ABA, binds to and inhibits SnRK2 protein kinases, which are positive regulators of ABA responses

  • Upon ABA treatment, is inhibited by OsPYLs-OsPP2C complexes, allowing for SnRK2 activation

  • Shows rapid induction at both transcript and protein levels following ABA treatment, creating a negative feedback loop that suppresses excessive ABA signaling

This negative regulatory role is consistent with the function of other clade A PP2Cs in plants. Experimental approaches to study this function have included:

  • Yeast two-hybrid assays to identify protein interactions

  • Co-immunoprecipitation to confirm interactions in vivo

  • In vitro phosphatase activity assays using recombinant proteins

  • Transgenic rice lines with altered OsPP2C09 expression levels

How does OsPP2C09 balance plant growth and drought tolerance in rice?

OsPP2C09 plays a crucial role in mediating the trade-off between plant growth and drought tolerance in rice through several mechanisms:

  • Growth promotion: OsPP2C09 positively affects plant growth under normal conditions by preventing unnecessary activation of stress responses that would otherwise suppress growth

  • Stress response regulation: Acts as a negative regulator of drought tolerance through ABA signaling by inhibiting ABA-responsive pathways

  • Differential root-shoot expression: The higher expression of OsPP2C09 in roots compared to shoots, especially under stress conditions, may contribute to increasing the root-to-shoot ratio, which enhances water acquisition during drought

  • ABA desensitization: OsPP2C09-mediated ABA desensitization contributes to root elongation under drought stress conditions, allowing plants to explore deeper soil layers for water

This delicate balance helps rice plants optimize fitness and survival by dynamically adjusting growth and stress responses according to environmental conditions. Modulating OsPP2C09 expression or activity could be a potential approach for developing rice varieties with improved drought tolerance without severe growth penalties.

What experimental systems have been used to study the in vivo function of OsPP2C09?

Several experimental systems and approaches have been employed to study OsPP2C09 function in vivo:

  • Transgenic rice lines:

    • Overexpression lines (OsPP2C09-OE): Plants overexpressing OsPP2C09 show reduced ABA sensitivity and drought tolerance but enhanced growth

    • Loss-of-function mutants: Display enhanced ABA sensitivity and drought tolerance but compromised growth

  • Protein interaction studies:

    • Yeast two-hybrid (Y2H) screening to identify interaction partners

    • Bimolecular fluorescence complementation (BiFC) assays in rice protoplasts to visualize protein interactions in planta

    • Co-immunoprecipitation (Co-IP) to confirm protein-protein interactions in vivo

  • Subcellular localization:

    • GFP fusion proteins to determine subcellular localization in rice protoplasts

    • Confocal microscopy to visualize protein localization

  • Expression analysis:

    • Quantitative real-time PCR (qRT-PCR) to quantify transcript levels under various treatments and in different tissues

    • Western blotting to detect protein levels

  • Physiological assays:

    • Drought tolerance assays under controlled conditions

    • Root and shoot growth measurements

    • Water loss measurements

These complementary approaches provide a comprehensive understanding of OsPP2C09 function in the context of ABA signaling, growth regulation, and stress responses.

How is OsPP2C09 regulated post-translationally in response to stress conditions?

OsPP2C09 undergoes several complex post-translational modifications in response to stress:

  • Ubiquitination and degradation:

    • OsRF1, a RING finger E3 ligase induced by ABA and stress, directly interacts with OsPP2C09

    • OsRF1 exhibits E3 ligase activity and targets OsPP2C09 for ubiquitination and subsequent protein degradation

    • Cell-free degradation assays have shown that OsPP2C09 protein is more rapidly degraded in response to ABA treatment in plant extracts

  • Oxidative regulation:

    • OsPP2C09 activity can be inhibited by H₂O₂ produced by NADPH oxidases (RbohB/E) in response to ABA

    • ABA-induced H₂O₂ production can oxidize cysteine residues in PP2C proteins, forming intermolecular dimers and inactivating the phosphatase

    • This oxidation mechanism represents a direct link between ABA signaling and redox status in the cell

  • Phosphorylation status:

    • As a phosphatase, OsPP2C09 can itself be regulated by phosphorylation events, though specific kinases targeting OsPP2C09 remain to be fully characterized

These post-translational regulatory mechanisms provide additional layers of control over OsPP2C09 activity beyond transcriptional regulation, allowing for rapid responses to changing environmental conditions.

What are the protein-protein interaction networks involving OsPP2C09 in rice?

OsPP2C09 participates in several protein-protein interaction networks that mediate its biological functions:

  • Core ABA signaling components:

    • OsPYL/RCAR ABA receptors: Direct interaction with OsPP2C09, which is enhanced in the presence of ABA

    • SnRK2 protein kinases: OsPP2C09 inhibits SnRK2s through dephosphorylation in the absence of ABA

  • Ubiquitination machinery:

    • OsRF1 (RING finger E3 ligase): Directly interacts with OsPP2C09 and targets it for ubiquitination and degradation

    • This interaction represents a regulatory mechanism to control OsPP2C09 protein levels during stress responses

  • Transcription factors:

    • OsPP2C09 may indirectly regulate transcription factors involved in ABA responses through its effects on SnRK2 kinases, which phosphorylate and activate transcription factors like ABFs (ABA-responsive element binding factors)

  • Proteins involved in nitrogen utilization:

    • OsPP2C09 has been implicated in enhancing nitrogen uptake and assimilation by regulating nitrate reductase activation via dephosphorylation of SnRK1 and 14-3-3 proteins

  • Interaction with OsMADS16:

    • OsPP2C09 has been identified as an interacting partner of OsMADS16, a transcription factor involved in floral organ development

    • This suggests potential roles for OsPP2C09 beyond stress responses in developmental processes

These interaction networks place OsPP2C09 at the intersection of multiple signaling pathways, highlighting its importance in coordinating various physiological responses in rice.

In vitro phosphatase activity assays:

  • Recombinant protein preparation:

    • Express OsPP2C09 in E. coli as a fusion protein (GST, His, or MBP tag)

    • Purify using affinity chromatography followed by gel filtration to ensure homogeneity

    • Alternative: Use plant-derived OsPP2C09 through immunoprecipitation from transgenic plants

  • Colorimetric phosphatase assays:

    • Synthetic substrates: Use p-nitrophenyl phosphate (pNPP), measuring absorbance at 405 nm

    • Reaction buffer: Include Mg²⁺ or Mn²⁺ (5-10 mM) as PP2Cs are metal-dependent phosphatases

    • Controls: Include phosphatase inhibitors (okadaic acid, calyculin A) to verify specificity

  • Protein substrate dephosphorylation:

    • Use pre-phosphorylated proteins (e.g., autophosphorylated SnRK2s) as substrates

    • Detect phosphorylation status by:

      • ³²P-labeling and autoradiography

      • Phospho-specific antibodies and western blotting

      • Mass spectrometry to identify specific dephosphorylated residues

  • Oxidation sensitivity analysis:

    • Incubate recombinant PP45 protein with H₂O₂ (0.1 mM) for 30 min

    • Test the effect of reducing agents (TCEP or DTT) on restoring activity

    • Analyze intermolecular dimer formation through non-reducing SDS-PAGE

In vivo phosphatase activity assessment:

  • Transgenic approaches:

    • Generate plants with altered OsPP2C09 expression (overexpression, knockdown, knockout)

    • Analyze phosphorylation status of known substrates (e.g., SnRK2s) by western blotting with phospho-specific antibodies

  • Phosphoproteomic analysis:

    • Compare phosphoproteomes of wild-type and OsPP2C09-modified plants using MS-based phosphoproteomics

    • Apply label-free quantitation (LFQ) to identify differentially phosphorylated proteins

    • Filter phosphosites based on valid quantitation values (at least 70% valid values in each condition)

  • Physiological readouts:

    • ABA sensitivity assays (germination, root growth, stomatal closure)

    • Drought tolerance phenotyping

    • Expression analysis of ABA-responsive genes as indirect indicators of OsPP2C09 activity

These complementary approaches provide a comprehensive assessment of OsPP2C09 phosphatase activity and its physiological significance.

How can OsPP2C09 be targeted for improving drought tolerance in rice?

OsPP2C09 represents a promising target for enhancing drought tolerance in rice through several potential approaches:

  • Genetic engineering strategies:

    • Tissue-specific downregulation: Using root or shoot-specific promoters to drive RNAi or CRISPR-Cas9 constructs targeting OsPP2C09, which could enhance ABA sensitivity and drought tolerance while minimizing negative effects on growth

    • Inducible systems: Employing drought or stress-inducible promoters to control OsPP2C09 expression, allowing for normal growth under favorable conditions and enhanced stress responses during drought

    • Protein engineering: Creating modified versions of OsPP2C09 with altered sensitivity to ABA or H₂O₂, potentially fine-tuning the balance between growth and stress tolerance

  • Chemical approaches:

    • Small molecule modulators: Developing compounds that specifically inhibit OsPP2C09 phosphatase activity during drought stress

    • ABA agonists: Using chemicals that enhance ABA signaling by affecting the PP2C-PYL interaction

  • Breeding approaches:

    • Allele mining: Identifying natural variants of OsPP2C09 in rice germplasm with altered activity or regulation that confer improved drought tolerance without severe growth penalties

    • Marker-assisted selection: Using OsPP2C09 as a marker for selecting drought-tolerant varieties in breeding programs

The methodological considerations for these approaches should include:

  • Careful phenotyping for both drought tolerance and growth parameters under various conditions

  • Analysis of potential pleiotropic effects on other agronomic traits

  • Field testing under realistic drought scenarios

  • Assessment of yield stability across environments

What roles does OsPP2C09 play in nitrogen utilization efficiency (NUE) in rice?

OsPP2C09 has emerged as an important regulator of nitrogen utilization efficiency (NUE) in rice through several mechanisms:

  • Regulation of nitrate reductase activity:

    • OsPP2C09 enhances N uptake and assimilation by regulating nitrate reductase activation through the dephosphorylation of SnRK1 and 14-3-3 proteins

    • This dephosphorylation prevents the inhibition of nitrate reductase, a key enzyme in nitrogen assimilation

  • Differential protein expression under nitrogen-deficient conditions:

    • Transgenic rice lines overexpressing OsPP2C09 (PP2C9TL) show significantly improved NUE compared to wild-type (kitaake) under limited nitrogen supply conditions

    • Proteomics analysis of these lines has revealed differential expression of proteins involved in nitrogen metabolism

  • Integration with stress responses:

    • OsPP2C09's involvement in both ABA signaling and nitrogen utilization suggests a potential crosstalk between stress responses and nutrient acquisition

    • This integration may help plants optimize resource allocation under combined stress and nutrient limitation conditions

Methodological approaches to study OsPP2C09's role in NUE include:

  • Comparative proteomics of OsPP2C09 overexpression lines and wild-type plants under varying nitrogen conditions

  • Enzyme activity assays for key nitrogen metabolism enzymes

  • ¹⁵N isotope labeling to track nitrogen uptake and assimilation efficiency

  • Field trials with different nitrogen application rates to assess agronomic performance

How does OsPP2C09 interact with other signaling pathways beyond ABA responses?

OsPP2C09 functions extend beyond ABA signaling, intersecting with multiple pathways that coordinate plant responses to environmental and developmental cues:

  • Interaction with floral development pathways:

    • OsPP2C09 has been identified as an interacting partner of OsMADS16, a transcription factor involved in floral organ development and patterning

    • This interaction occurs in the nucleus, as confirmed by BiFC assays

    • The functional significance of this interaction suggests OsPP2C09 may play roles in reproductive development beyond stress responses

  • Crosstalk with reactive oxygen species (ROS) signaling:

    • OsPP2C09 activity is sensitive to H₂O₂ produced by NADPH oxidases (RbohB/E) in response to ABA

    • This oxidative regulation connects OsPP2C09 to the broader ROS signaling network in plants

    • The specific cysteine residues in OsPP2C09 that are susceptible to oxidation represent potential targets for engineering oxidation-insensitive variants

  • Integration with nutrient signaling:

    • OsPP2C09's involvement in nitrogen utilization through regulation of nitrate reductase activity suggests connections to nutrient sensing pathways

    • SnRK1, a target of OsPP2C09, is a central regulator of energy and nutrient homeostasis in plants

  • Potential involvement in biotic stress responses:

    • The interaction with OsMADS16 and roles in ABA signaling suggest OsPP2C09 may indirectly influence pathogen responses

    • Other PP2Cs in rice, such as XB15, directly regulate innate immunity pathways by dephosphorylating pattern recognition receptors

Research methods to explore these crosstalks include:

  • RNA-seq analysis of OsPP2C09 overexpression or knockout lines under various conditions

  • ChIP-seq to identify genome-wide binding sites of transcription factors affected by OsPP2C09

  • Metabolomics analysis to detect changes in primary and secondary metabolites

  • Protein interactome mapping using techniques like proximity labeling (BioID) or affinity purification coupled with mass spectrometry

What are the best experimental systems for studying OsPP2C09 function in rice?

Several experimental systems can be employed to study OsPP2C09 function, each with specific advantages for addressing different research questions:

  • Rice protoplast transient expression system:

    • Advantages: Rapid results (24-48 hours), allows high-throughput screening, suitable for protein localization, BiFC, and protein-protein interaction studies

    • Applications: Subcellular localization of OsPP2C09-GFP fusions, validation of protein interactions through BiFC or Co-IP, promoter activity assays

    • Methodology: Isolation of protoplasts from rice seedlings, PEG-mediated transformation with expression constructs, confocal microscopy for visualization

  • Transgenic rice lines:

    • Advantages: Allows whole-plant physiological studies, suitable for long-term and developmental analyses, enables field evaluations

    • Types of transgenic lines:

      • Overexpression lines using constitutive (Ubi, 35S) or tissue-specific promoters

      • Knockout/knockdown lines using CRISPR-Cas9 or RNAi

      • Reporter lines with promoter-GUS/GFP fusions to study expression patterns

    • Applications: Drought tolerance assays, developmental analyses, agronomic performance evaluations

  • Heterologous expression systems:

    • Bacterial expression (E. coli): For producing recombinant OsPP2C09 protein for biochemical and structural studies

    • Yeast systems: For protein-protein interaction studies (Y2H) and functional complementation assays

    • Tobacco leaf infiltration: For transient expression and protein interaction studies in a plant system

  • In vitro biochemical systems:

    • Purified recombinant proteins: For enzyme kinetics, substrate specificity, and inhibitor studies

    • Cell-free degradation assays: To study post-translational modifications and protein stability

  • Computational and structural biology approaches:

    • Homology modeling of OsPP2C09 structure

    • Molecular dynamics simulations to study protein-substrate interactions

    • Genome-wide association studies (GWAS) to identify natural variants

Each system should be selected based on the specific research question, with multiple complementary approaches often providing the most comprehensive understanding of OsPP2C09 function.

What are the critical controls needed when conducting OsPP2C09 phosphatase activity assays?

Designing rigorous OsPP2C09 phosphatase activity assays requires careful consideration of multiple controls to ensure reliable and interpretable results:

  • Enzyme controls:

    • Enzyme blanks: Reaction mixture without OsPP2C09 to measure background hydrolysis of substrates

    • Heat-inactivated enzyme: OsPP2C09 denatured by heating (95°C, 10 min) to control for non-enzymatic effects

    • Catalytically inactive mutant: OsPP2C09 with mutations in key catalytic residues (e.g., metal-coordinating aspartates) to verify specificity of activity

    • Related PP2Cs: Other rice PP2C family members to compare substrate specificity and activity levels

  • Reaction condition controls:

    • Metal ion dependency: Reactions with and without Mg²⁺/Mn²⁺, or with EDTA to chelate metal ions (PP2Cs are metal-dependent)

    • pH range: Multiple buffer systems to determine optimal pH and ensure activity is measured under appropriate conditions

    • Temperature optimization: Assays at different temperatures to determine optimal conditions for rice PP2C activity

  • Inhibition controls:

    • Known PP2C inhibitors: Such as okadaic acid (low sensitivity), tautomycin, or ABA-receptor complexes

    • H₂O₂ treatment: To assess sensitivity to oxidative inhibition

    • Reducing agents: DTT or TCEP to reverse potential oxidative inhibition

  • Substrate controls:

    • Non-phosphorylated substrates: To detect any non-specific activity

    • Phosphatase-resistant substrate analogs: To verify specificity for phosphate group removal

    • Different phosphorylated amino acids: Substrates with phospho-serine, phospho-threonine, and phospho-tyrosine to confirm specificity

  • Time course and enzyme concentration ranges:

    • Multiple time points: To ensure measurements are taken in the linear range of the reaction

    • Enzyme dilution series: To establish a relationship between enzyme concentration and activity

When reporting results, important parameters to include are:

  • Specific activity (nmol phosphate released/min/mg protein)

  • KM and Vmax values for different substrates

  • IC50 values for inhibitors

  • pH and temperature optima

  • Cofactor requirements and concentrations

How can researchers resolve contradictory findings about OsPP2C09 function in different experimental systems?

Researchers encountering contradictory findings about OsPP2C09 function across different experimental systems should employ a systematic approach to resolve these discrepancies:

  • Comprehensive literature analysis:

    • Metadata comparison: Create a detailed comparison table of experimental conditions, genotypes, and methodologies used in different studies

    • Timeline of developments: Trace how understanding of OsPP2C09 has evolved as new techniques became available

    • Citation network analysis: Identify how different research groups build upon each other's work

  • Standardization of experimental conditions:

    • Growth conditions: Standardize plant growth conditions (light, temperature, humidity, growth media)

    • Developmental stage: Compare plants at equivalent developmental stages rather than chronological age

    • Stress application protocols: Use consistent methods for applying drought, ABA, or other treatments

  • Direct replication studies:

    • Multi-laboratory validation: Conduct identical experiments in different laboratories

    • Blind experimental design: Implement blinding procedures for phenotypic scoring

    • Pre-registration: Pre-register experimental design and analysis plans before conducting experiments

  • Integrative approaches to resolve contradictions:

    • Comparative analysis across multiple rice varieties: Test whether observed effects are genotype-specific

    • Temporal resolution: Examine time-course responses rather than single time points to capture dynamic changes

    • Dose-response relationships: Test multiple concentrations of treatments rather than single doses

  • Advanced techniques to address limitations:

    • Single-cell approaches: RNA-seq or proteomics at single-cell resolution to address tissue heterogeneity

    • In vivo phosphatase activity sensors: Develop FRET-based sensors to monitor OsPP2C09 activity in living cells

    • Tissue-specific gene manipulation: Use tissue-specific promoters for more precise spatial control of expression

  • Computational modeling to reconcile data:

    • Mathematical modeling: Develop quantitative models of ABA signaling networks that can predict system behavior

    • Meta-analysis: Statistically combine results from multiple studies to identify consistent patterns

    • Bayesian frameworks: Update confidence in different hypotheses as new evidence emerges

Research QuestionPotential ContradictionsResolution Approach
Growth vs. stress toleranceOsPP2C09 may show positive effects on growth but negative effects on stress toleranceExamine context-dependency: nutrient status, developmental stage, stress intensity, recovery periods
Tissue-specific functionsDifferent phenotypes observed in root vs. shoot-focused studiesUse tissue-specific promoters to manipulate OsPP2C09 in specific cell types
Interaction with OsMADS16Functional significance unclear across studiesInvestigate developmental stage-specific interactions and temporal regulation
Role in nitrogen utilizationVariance in impact on NUE across studiesStandardize nitrogen regimes and consider interactions with other nutrients

By systematically addressing these potential sources of contradiction, researchers can develop a more nuanced and comprehensive understanding of OsPP2C09 function in rice.

What emerging technologies could advance our understanding of OsPP2C09 function in rice?

Several cutting-edge technologies hold promise for deeper insights into OsPP2C09 function:

  • CRISPR-based technologies:

    • Base editing: For introducing specific point mutations in OsPP2C09 without double-strand breaks

    • Prime editing: To make precise edits in regulatory regions controlling OsPP2C09 expression

    • CRISPR activation/interference (CRISPRa/CRISPRi): For tunable, tissue-specific modulation of OsPP2C09 expression

    • CRISPR-mediated knock-in: To introduce reporter tags at endogenous loci for visualizing native protein dynamics

  • Advanced imaging techniques:

    • Single-molecule tracking: To visualize OsPP2C09 dynamics and interactions in living cells

    • FRET/FLIM sensors: To develop biosensors for monitoring OsPP2C09 activity or ABA signaling in real-time

    • Expansion microscopy: For super-resolution imaging of protein complexes involving OsPP2C09

    • Light-sheet microscopy: For whole-organ imaging of signaling dynamics in intact rice seedlings

  • Single-cell and spatial technologies:

    • Single-cell RNA-seq: To uncover cell type-specific responses to OsPP2C09 manipulation

    • Spatial transcriptomics: To map expression patterns with high spatial resolution

    • Proteomics at single-cell resolution: To analyze protein-level changes in specific cell types

  • Protein engineering approaches:

    • Optogenetic control: Light-inducible OsPP2C09 activity for spatiotemporal manipulation

    • Chemical genetics: Engineered OsPP2C09 variants sensitive to specific small molecules

    • Proximity labeling (BioID, TurboID): To identify transient interaction partners in living cells

    • Protein structure prediction (AlphaFold2): To model OsPP2C09 structure and design specific modulators

  • Systems biology integration:

    • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data

    • Network inference algorithms: To place OsPP2C09 in the broader signaling network of rice

    • Digital twin modeling: Creating virtual models of rice plants with different OsPP2C09 variants

These emerging technologies, when applied to OsPP2C09 research, could reveal new dimensions of its function in coordinating growth, development, and stress responses in rice.

What are the most important unresolved questions about OsPP2C09 that require further investigation?

Despite significant advances in understanding OsPP2C09, several critical questions remain unresolved:

  • Structural biology questions:

    • What is the three-dimensional structure of OsPP2C09, and how does it compare to other PP2Cs?

    • What structural changes occur upon binding to PYL/RCAR receptors or other interacting proteins?

    • Which specific amino acid residues are critical for substrate recognition and catalysis?

    • How do post-translational modifications affect OsPP2C09 structure and function?

  • Regulatory network questions:

    • What is the complete set of OsPP2C09 substrates in different tissues and under various conditions?

    • How is OsPP2C09 expression precisely regulated at transcriptional, post-transcriptional, and epigenetic levels?

    • What is the functional significance of the interaction between OsPP2C09 and OsMADS16 in floral development?

    • How does OsPP2C09 integrate signals from multiple stress and developmental pathways?

  • Physiological role questions:

    • How does OsPP2C09 fine-tune the balance between growth and stress responses across different developmental stages?

    • What role does OsPP2C09 play in reproductive development and seed filling under stress conditions?

    • How does differential expression of OsPP2C09 in roots versus shoots contribute to whole-plant drought responses?

    • What is the evolutionary history of OsPP2C09 and how has its function diversified across rice varieties and related grass species?

  • Applied research questions:

    • Can OsPP2C09 be targeted to improve both drought tolerance and nitrogen use efficiency simultaneously?

    • What natural variants of OsPP2C09 exist in rice germplasm, and do they contribute to stress adaptation in local landraces?

    • How do OsPP2C09-mediated responses interact with other agronomically important traits like yield components and disease resistance?

    • Can chemical modulators of OsPP2C09 activity be developed as agricultural treatments to enhance stress tolerance?

Addressing these questions will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, systems biology, and field-based agronomy.

How might findings about OsPP2C09 in rice translate to other crop species for improving agricultural sustainability?

The knowledge gained from OsPP2C09 studies in rice has significant potential for translational applications in other crops:

  • Comparative genomics approaches:

    • Identify PP2C9 orthologs in other cereals (wheat, maize, barley) and non-cereal crops

    • Analyze conservation of protein domains, regulatory elements, and interaction interfaces

    • Develop phylogenetic frameworks to predict functional conservation across species

    CropPP2C9 OrthologSequence Identity to OsPP2C09Conservation of Key Domains
    WheatTaPP2C-A1~80%High in catalytic domain, variable in N-terminal region
    MaizeZmPP2C-A10~75%Conserved phosphatase domain, some variation in regulatory regions
    BarleyHvPP2C09~85%Highly conserved across full length
    SoybeanGmPP2C-A5~65%Conserved catalytic residues but divergent regulatory domains
  • Translational research strategies:

    • Targeted gene editing: Use CRISPR-Cas9 to modify orthologous PP2C genes in other crops based on knowledge from rice

    • Promoter engineering: Transfer insights about tissue-specific or stress-responsive expression patterns to other species

    • Transgenic approaches: Express modified OsPP2C09 variants in other crops to test functional conservation

    • Marker-assisted selection: Develop molecular markers for PP2C9 alleles associated with improved drought tolerance or NUE

  • Cross-species validation experiments:

    • Test whether manipulation of PP2C9 orthologs in other crops produces similar effects on ABA sensitivity, drought tolerance, and nitrogen use efficiency

    • Conduct field trials across multiple crop species and environments to assess agronomic impact

    • Analyze potential trade-offs between stress tolerance and productivity in different crop backgrounds

  • Broader agricultural applications:

    • Water-saving agriculture: Apply OsPP2C09 insights to develop crops with enhanced water use efficiency for water-limited environments

    • Low-input farming systems: Utilize knowledge about OsPP2C09's role in nitrogen utilization to develop varieties suited for reduced fertilizer application

    • Climate resilience: Develop crop varieties with improved ability to maintain productivity under increasingly variable climate conditions

  • Potential limitations and considerations:

    • Species-specific differences in ABA signaling architecture may affect outcomes

    • Different agricultural practices and environments may require tailored approaches

    • Regulatory considerations for gene-edited or transgenic crops vary globally

    • Stakeholder engagement is essential for successful adoption of new technologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.