Recombinant Oryza sativa subsp. japonica Probable xyloglucan glycosyltransferase 9 (CSLC9)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant CSLC9 is produced in Escherichia coli with an N-terminal His tag for purification and detection. Key specifications include:

PropertyDetails
UniProt IDQ6AU53
SpeciesOryza sativa subsp. japonica (Rice)
Expression HostE. coli
Protein LengthFull-length (1-595 amino acids)
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in sterile water with 5–50% glycerol recommended

The amino acid sequence includes conserved domains typical of glycosyltransferases, such as a catalytic GT2 family motif .

Biological Role in Xyloglucan Biosynthesis

CSLC9 is implicated in synthesizing the glucan backbone of XyG, a process critical for cell wall assembly and remodeling:

  • Function: CSLC proteins are glucan synthases that polymerize UDP-glucose into β-1,4-glucan chains, which are subsequently decorated with xylose, galactose, and fucose residues to form XyG .

  • Genetic Evidence: In Arabidopsis, quintuple cslc mutants lack detectable XyG, confirming CSLCs' non-redundant roles in glucan backbone synthesis .

  • Redundancy: Complementation studies show that all five Arabidopsis CSLC genes (including CSLC4, CSLC5, CSLC6, CSLC8, and CSLC12) can restore XyG biosynthesis, indicating functional overlap .

Functional Studies

  • Enzyme Activity: Heterologous expression of CSLC4 in Pichia pastoris produces cellodextrins, confirming glucan synthase activity. Co-expression with xylosyltransferases (e.g., XXT1) enhances chain elongation .

  • Phenotypic Impact: Arabidopsis cslc quintuple mutants exhibit mild developmental defects despite lacking XyG, challenging traditional views of XyG’s structural necessity .

Applications in Research

Recombinant CSLC9 is utilized in:

  • Mechanistic Studies: Elucidating XyG biosynthesis pathways and enzyme kinetics .

  • Plant Biotechnology: Engineering cell walls for improved biomass digestibility or stress tolerance .

  • Protein Interaction Assays: Identifying partners like xylosyltransferases (XXTs) using co-immunoprecipitation or yeast two-hybrid systems .

Future Directions

  • Subcellular Localization: Resolving whether CSLC9 operates in the Golgi apparatus or plasma membrane.

  • Crystallography: Solving 3D structures to guide enzyme engineering.

  • Crop Engineering: Modifying XyG content in rice to enhance agronomic traits .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
CSLC9; Os03g0770800; LOC_Os03g56060; OSJNBa0072F13.8; Probable xyloglucan glycosyltransferase 9; Cellulose synthase-like protein C9; OsCslC9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CSLC9
Target Protein Sequence
MAPWSGLWGGKLAAGESPVLRSRFYAFIRAFVVLSVLLLIVELGAYINGWDDLAASALAL PVIGVESLYASWLRFRATYVAPFIQFLTDACVVLFLIQSADRLIQCLGCFYIHLKRIKPN PKSPALPDAEDPDAAYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWPRSNFLVQVLDDSDD PTTQTLIREEVLKWQQNGARIVYRHRVLRDGYKAGNLKSAMSCSYVKDYEFVAIFDADFQ PNPDFLKRTVPHFKDNDELGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGIFLN FFGFNGTAGVWRIKALDDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESY EAYRKQQHRWHSGPMQLFRLCLPDIIKCKIVFWKKANLIFLFFLLRKLILPFYSFTLFCI ILPMTMFVPEAELPDWVVCYIPALMSLLNILPSPKSFPFIIPYLLFENTMSVTKFNAMIS GLFQLGNAYEWVVTKKSGRSSEGDLISLAPKELKHQKTESAPNLDAIAKEQSAPRKDVKK KHNRIYKKELALSLLLLTAAARSLLSKQGIHFYFLLFQGISFLLVGLDLIGEQIE
Uniprot No.

Target Background

Function
This protein is likely a beta-1,4-glucan synthase, potentially involved in synthesizing the xyloglucan backbone rather than cellulose. It appears to function concurrently with xyloglucan 6-xylosyltransferase. Xyloglucan is a non-cellulosic polysaccharide found in plant cell walls and consists of a glucan backbone with substitutions of xylose, galactose, and fucose.
Database Links

STRING: 39947.LOC_Os03g56060.1

UniGene: Os.10855

Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like C subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CSLC9 in Oryza sativa cell wall development?

CSLC9 (Probable xyloglucan glycosyltransferase 9) in Oryza sativa belongs to the glycosyltransferase family involved in cell wall biogenesis. The enzyme catalyzes the transfer of glycosyl groups to form xyloglucan polymers, which are critical components of the primary cell wall in rice. As a member of the cellulose synthase-like C (CSLC) family, it plays a specific role in xyloglucan backbone synthesis.

The mechanism of transglycosylation proceeds in two distinct stages incorporating two transition states:

  • Deprotonation of the carboxyl acid residue that acts as the nucleophile, attacking the anomeric carbon to form the glycosyl-enzyme intermediate complex

  • Formation of a new glycosidic bond after nucleophile attack on the anomeric carbon

This enzymatic activity is particularly important because it contributes to cell wall modifications that help rice adapt to environmental stresses, including drought and salt conditions, which are significant challenges in rice cultivation .

How does CSLC9 expression vary across different rice varieties and growth conditions?

Expression analysis reveals significant variability in CSLC9 expression across different rice varieties, particularly when comparing indica and japonica subspecies. Meta-analysis of RNA-sequencing data has uncovered distinct expression patterns under various environmental stresses.

Table 1: Comparative CSLC9 expression in different rice varieties under stress conditions

Rice VarietySubspeciesStress ConditionCSLC9 Expression LevelResearch Project ID
PokkaliindicaSalt stressUpregulatedERP003982
NipponbarejaponicaSalt stressModerately upregulatedSRP200410
Nagina 22indicaDrought stressHighly upregulatedSRP253184
IR29indicaSalt stressDownregulatedERP003983

Expression patterns are tissue-specific, with leaf samples showing the highest abundance of CSLC9 transcripts under stress conditions . In resistant varieties like Pokkali and Nagina 22, CSLC9 shows significant upregulation under stress conditions, suggesting its potential role in stress adaptation mechanisms through cell wall remodeling.

What conserved domains and motifs are essential for CSLC9 catalytic activity?

CSLC9 contains several conserved domains critical for its catalytic function. Based on structural analyses of related enzymes like PttXET16A, the catalytic machinery likely includes:

  • A nucleophilic glutamic acid residue that attacks the anomeric carbon of the donor substrate

  • An acid/base glutamic acid residue that protonates the released saccharide and subsequently deprotonates the glycosyl acceptor

  • An aspartic acid residue that controls the protonation state of the catalytic machinery through hydrogen bonding interactions

The catalytic domain typically adopts a (β/α)8 barrel fold, characteristic of many glycosyltransferases. Molecular dynamics simulations show that substrates undergo conformational changes during the reaction, with the reducing-end glucose moiety adopting a boat conformation during catalysis . Mutation of these key residues dramatically impacts the enzyme's ability to catalyze transglycosylation reactions, highlighting their essential role in the catalytic mechanism.

What are the optimal expression systems for producing recombinant CSLC9 with high activity?

The choice of expression system significantly impacts the quality, yield, and activity of recombinant CSLC9. Comparative studies of recombinant proteins expressed in different systems provide valuable insights applicable to CSLC9 production:

Table 2: Comparison of expression systems for recombinant glycosyltransferases

Expression SystemAdvantagesLimitationsGlycosylation PatternYield
Pichia pastorisHigh yield, protein secretionSome glycosylation differencesFewer glycated residuesHigh
Saccharomyces cerevisiaeWell-established, protein secretionSome glycosylation differencesFewer glycated residuesModerate
Oryza sativaNative glycosylationHigh variability, extensive glycationHigher number of hexose-glycated Arg/LysVariable
E. coliSimple, cost-effectiveLacks post-translational modificationsNo glycosylationHigh

Research on recombinant proteins expressed in rice revealed extensive glycation of arginine and lysine residues, which affected protein structure and function. Yeast-based expression systems (Pichia pastoris and Saccharomyces cerevisiae) showed fewer glycated residues, potentially offering better control over protein quality .

What assays are most effective for measuring CSLC9 enzymatic activity in vitro?

Several assay methods can be employed to measure CSLC9 enzymatic activity, each with specific advantages:

  • Radiochemical assays: Using radio-labeled donor or acceptor substrates to track the formation of labeled reaction products. This method is highly sensitive but requires specialized facilities for handling radioactive materials.

  • Fluorescence-based assays: Utilizing fluorescently labeled acceptor oligosaccharides to detect transglycosylation products. The choice of fluorescent tag is critical, and methods to efficiently remove excess substrate are essential .

  • Colorimetric assays: Based on the formation of colored complexes with reaction products, such as the blue-green-colored iodine-xyloglucan complex. This method is simpler but may be less sensitive than other approaches .

  • Viscometric assays: Measuring changes in the viscosity of substrate solutions as a result of enzymatic activity. This approach provides real-time monitoring of reaction progress.

  • NMR spectroscopy: Allowing direct observation of substrate-enzyme interactions and product formation. This technique provides detailed structural information but requires specialized equipment and higher amounts of purified enzyme .

For high-throughput screening, fluorescence-based assays with appropriate fluorescent tags are recommended. For detailed mechanistic studies, combining radiochemical assays with NMR spectroscopy provides comprehensive insights into the catalytic mechanism of CSLC9.

How can I analyze lot-to-lot variability in recombinant CSLC9 preparations?

Lot-to-lot variability is a significant concern in recombinant protein research. For CSLC9, the following analytical techniques help assess and control variability:

  • Size exclusion chromatography (SEC): Evaluates the heterogeneity of protein preparations and detects high molecular weight aggregates. SEC can identify differences in the monomer-to-aggregate ratio between lots .

  • Reversed-phase high-performance liquid chromatography (RP-HPLC): Analyzes the hydrophobicity profile of the protein, which can be affected by post-translational modifications and conformational changes .

  • Capillary electrophoresis (CE): Separates proteins based on their charge-to-mass ratio, providing insights into charge heterogeneity from variable post-translational modifications .

  • Liquid chromatography-mass spectrometry (LC-MS): Identifies specific modifications, such as glycation sites and their extent, allowing for detailed comparison between lots .

  • Circular dichroism (CD) and fluorescence spectroscopy: Assess secondary and tertiary structure, respectively, to detect structural alterations that might affect enzymatic activity .

In studies of recombinant proteins expressed in rice, LC-MS analysis identified supplier-to-supplier and lot-to-lot variability in the degree of glycation at specific lysine and arginine residues. Both the number of glycated residues and the degree of glycation correlated positively with the quantity of non-monomeric species and altered chromatographic profiles .

How do I interpret contradictory results from different assays measuring CSLC9 activity?

When faced with contradictory results from different CSLC9 activity assays, a systematic approach to data analysis is essential:

  • Examine assay principles: Different assays measure different aspects of enzymatic activity. Radiochemical assays directly track substrate incorporation, while fluorescence-based assays monitor product formation through fluorescent tags. Understanding these differences can explain apparent discrepancies.

  • Consider enzyme-substrate interactions: The conformation of xyloglucan substrates changes during enzymatic reactions, with the reducing-end glucose moiety adopting a boat conformation during catalysis . Different assays may be differentially sensitive to these conformational changes.

  • Analyze experimental conditions: Variables such as pH, temperature, buffer composition, and the presence of potential inhibitors or activators significantly impact enzyme activity measurements. Standardizing these conditions across assays can help resolve contradictions.

  • Apply statistical analysis: Use appropriate statistical methods to determine if differences between assay results are statistically significant. Research methods literature emphasizes that "decisions are important throughout the practice of research and are designed to help researchers collect evidence that includes the full spectrum of the phenomenon under study, to maintain logical rules, and to mitigate or account for possible sources of bias" .

  • Evaluate post-translational modifications: As observed with recombinant proteins expressed in rice, extensive glycation can affect tertiary structure and function . Different assays may be differentially sensitive to these modifications.

Creating a comprehensive table that compares assay conditions, principles, and results side by side can help identify patterns that explain discrepancies and guide further experiments.

What bioinformatic tools are most useful for analyzing CSLC9 gene expression across different rice varieties?

For comprehensive analysis of CSLC9 gene expression across different rice varieties, several bioinformatic approaches are particularly valuable:

Table 3: Recommended bioinformatic tools for CSLC9 expression analysis

Analysis TypeRecommended ToolsKey Features
RNA-seq processingHISAT2, STAR, featureCountsAlignment and quantification
Meta-analysismetaRNASeq, metaSeqIntegration of multiple datasets
Visualizationggplot2, ComplexHeatmapExpression patterns and correlations
ClusteringWard.D2 with Gower's distanceGrouping similar expression profiles
Pathway analysisGSEA, DAVID, STRINGFunctional interpretation

When comparing CSLC9 expression across varieties, it's essential to consider both subspecies differences (indica vs. japonica) and stress responses. Research on rice under stress conditions has shown that expression clustering can identify functionally relevant groups of varieties .

The Ward.D2 method with Gower's distance matrix has been successfully applied to cluster rice varieties based on phenotypic and genotypic data related to stress tolerance . This approach can reveal patterns in CSLC9 expression that correlate with specific physiological responses to environmental challenges.

How can I determine if observed changes in CSLC9 expression are biologically significant?

Determining the biological significance of observed changes in CSLC9 expression requires a multi-faceted approach beyond simple statistical significance:

  • Statistical analysis: Apply appropriate statistical tests to determine if expression changes are statistically significant. For RNA-seq data, use tools like DESeq2 or edgeR that account for the specific characteristics of count data.

  • Effect size assessment: Evaluate the magnitude of expression changes. Small but statistically significant changes might not be biologically relevant, while larger changes are more likely to impact cellular functions.

  • Expression correlation analysis: Examine if CSLC9 expression changes correlate with other genes involved in cell wall biosynthesis or stress response pathways. Coordinated expression suggests functional relevance.

  • Phenotypic correlation: Correlate gene expression with phenotypic traits to establish biological significance. For example, if CSLC9 expression correlates with stress tolerance metrics like Anaerobic Germination Percentage (AGP) or Response Index (RI), this supports biological relevance .

  • Comparative analysis across varieties: Compare expression patterns between resistant and susceptible varieties under stress conditions. Research has shown that "tolerant landraces possessed significantly higher shoot lengths under stress than the control genotypes" , linking gene expression to adaptive phenotypes.

  • Validation through multiple methods: Confirm expression changes using independent techniques such as qRT-PCR, which provides more precise quantification for specific genes of interest.

The biological significance of CSLC9 expression changes should be interpreted in the context of cell wall modifications that contribute to stress adaptation, such as the rapid shoot elongation identified as an indicator of Anaerobic Germination Tolerance .

How can CSLC9 be engineered to enhance drought and salt stress tolerance in rice?

Engineering CSLC9 to enhance stress tolerance requires a comprehensive understanding of its role in cell wall modifications during stress responses. Several sophisticated approaches can be considered:

  • Promoter modification: Replace the native CSLC9 promoter with stress-inducible promoters to enhance expression specifically under stress conditions. Analysis of drought and salt-responsive genes in rice has identified several promoter elements that could be utilized .

  • Protein engineering: Modify specific amino acid residues in CSLC9 to enhance catalytic efficiency or substrate specificity. The catalytic mechanism involving nucleophilic attack on the anomeric carbon provides targets for rational design.

  • Expression system optimization: When producing recombinant CSLC9, the choice of expression system is critical. Studies have shown that proteins expressed in Oryza sativa exhibit extensive glycation that affects their structure and function .

  • Co-expression strategies: Engineer CSLC9 alongside other cell wall-modifying enzymes or stress-responsive genes to create synergistic effects. Research on anaerobic germination in rice has identified several QTLs that could complement CSLC9 function, such as OsTPP7 (trehalose-6-phosphate phosphatase) on chromosome 9 .

  • CRISPR-Cas9 genome editing: Precisely modify the CSLC9 gene or its regulatory elements using CRISPR-Cas9 to create varieties with enhanced stress tolerance without introducing foreign DNA.

What approaches can be used to study CSLC9 interactions with other cell wall enzymes?

Understanding interactions between CSLC9 and other cell wall enzymes requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Identify proteins that physically interact with CSLC9 in vivo by using antibodies specific to CSLC9, isolating protein complexes, and identifying components using mass spectrometry.

  • Yeast two-hybrid (Y2H) screening: Detect binary protein-protein interactions by expressing CSLC9 as a bait protein and screening against a library of potential interacting partners from rice cell wall biosynthesis pathways.

  • Bimolecular Fluorescence Complementation (BiFC): Visualize protein interactions in vivo by expressing proteins of interest fused to complementary fragments of a fluorescent protein. Interaction brings the fragments together, restoring fluorescence.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics and affinity between CSLC9 and potential interacting partners, providing quantitative data on interaction strength.

  • Enzyme activity assays with combined proteins: Measure CSLC9 activity in the presence of other cell wall enzymes to reveal functional interactions. XET activity assays using labeled oligosaccharide probes can be utilized in high-throughput polysaccharide microarrays .

  • Genetic approaches: Create double mutants or co-expression lines to reveal genetic interactions. Synergistic or antagonistic phenotypes suggest functional relationships between genes.

  • Structural biology approaches: Employ X-ray crystallography or cryo-electron microscopy to determine three-dimensional structures of enzyme complexes, revealing the molecular basis of interactions.

When studying CSLC9 interactions, consider both direct physical interactions and indirect functional relationships within the complex network of enzymes and structural components that comprise the plant cell wall.

How does CSLC9 activity contribute to cell wall remodeling during rice development and stress responses?

CSLC9's role in cell wall remodeling during rice development and stress responses is complex and context-dependent:

  • Developmental regulation: CSLC9 activity is developmentally regulated, with expression patterns varying across tissues and growth stages. Whole-genome analysis of Oryza sativa has revealed tissue-specific expression patterns of gene families that extend to cell wall-related genes like CSLC9 .

  • Stress-induced remodeling: Under stress conditions, cell wall composition and architecture undergo significant changes. Research on drought and salt stress in rice has identified differential expression of cell wall-related genes in resistant versus susceptible varieties . CSLC9 contributes to these adaptive modifications.

  • Catalytic mechanism: The transglycosylation mechanism of xyloglucan transferases involves two stages with two transition states: nucleophilic attack on the anomeric carbon followed by formation of a new glycosidic bond . This allows precise modification of cell wall polysaccharides during development and stress response.

  • Integration with hormone signaling: Cell wall remodeling is coordinated with hormone signaling pathways. Analysis of two-component signaling (TCS) in rice has shown involvement in cytokinin signaling, ethylene signaling, and light perception , potentially influencing CSLC9 activity.

  • Tissue-specific functions: Different tissues utilize CSLC9 for specific adaptive responses. In anaerobic germination, rapid coleoptile elongation is a key adaptive response , involving CSLC9-mediated cell wall modifications that allow cells to expand rapidly while maintaining structural integrity.

Understanding CSLC9's contribution to cell wall remodeling requires integrating molecular, cellular, and physiological data. Methods like in vivo visualization using labeled oligosaccharide probes provide direct evidence of enzyme activity during developmental processes and stress responses.

Why might recombinant CSLC9 show reduced activity compared to the native enzyme?

Several factors can contribute to reduced activity of recombinant CSLC9:

  • Post-translational modifications: Studies on recombinant proteins expressed in Oryza sativa have shown extensive glycation of arginine and lysine residues, affecting protein structure and function . The number and pattern of these modifications differ between recombinant and native enzymes.

  • Improper folding: Recombinant expression systems may not fully recapitulate the folding environment of the native cell, leading to subtle structural differences that affect catalytic activity.

  • Expression system effects: Different expression systems produce proteins with distinct characteristics. Research has shown that proteins expressed in rice had "a greater number of hexose-glycated arginine and lysine residues" compared to those expressed in yeast .

  • Purification-induced changes: The purification process may alter protein structure or remove necessary cofactors. Size exclusion chromatography can identify high molecular weight aggregates that form during purification .

  • Buffer and reaction conditions: Optimal conditions for recombinant CSLC9 activity may differ from those of the native enzyme due to structural differences or contaminants from the expression system.

  • Substrate availability and presentation: The native cellular environment may present substrates in specific orientations or concentrations difficult to replicate in vitro.

To address reduced activity, systematic optimization of expression systems, purification protocols, and reaction conditions is essential. Comparing different expression systems (yeast, bacteria, plant-based) helps identify the approach that best preserves enzymatic activity.

How can I optimize experimental conditions to maintain CSLC9 stability and activity?

Optimizing experimental conditions for CSLC9 stability and activity requires attention to multiple factors:

  • Buffer composition: pH, ionic strength, and specific ions significantly impact enzyme stability and activity. For glycosyltransferases, buffers containing divalent cations like Mg²⁺ or Mn²⁺ are often beneficial for catalytic activity.

  • Temperature control: Thermal stability is critical for enzyme activity. Studies on recombinant proteins have shown that certain compounds, such as fatty acids, can dramatically improve thermal stability . Identifying such stabilizing agents for CSLC9 enhances activity and longevity.

  • Storage conditions: Proper storage is essential for maintaining enzyme activity:

    • Short-term storage at 4°C in appropriate buffer

    • Flash-freezing in liquid nitrogen and storage at -80°C

    • Addition of glycerol or other cryoprotectants before freezing

    • Lyophilization for long-term storage

  • Substrate considerations: The concentration, purity, and structural integrity of substrates affect enzyme activity measurements. For xyloglucan transferases, substrate conformation is particularly important, as "the XG nonasaccharide of the reducing-end glucose moiety changed its conformation into a boat at the beginning of the simulation and kept this conformation during the whole simulation time" .

  • Reducing agent addition: Including reducing agents like DTT or β-mercaptoethanol prevents oxidation of cysteine residues, potentially important for CSLC9 structure and function.

  • Protein concentration: Working at appropriate protein concentrations prevents aggregation while maintaining sufficient activity for detection. Size exclusion chromatography monitors and controls the monomer-to-aggregate ratio .

  • Avoiding freeze-thaw cycles: Repeated freezing and thawing leads to protein denaturation and activity loss. Aliquoting enzyme preparations before freezing minimizes this issue.

Systematic optimization of these conditions through Design of Experiments (DoE) approaches efficiently identifies optimal combinations for maintaining CSLC9 stability and activity.

What are the common pitfalls in interpreting CSLC9 activity data and how can they be avoided?

Interpreting CSLC9 activity data requires awareness of several common pitfalls:

By addressing these potential pitfalls, researchers can generate more reliable and meaningful data on CSLC9 activity, contributing to a deeper understanding of its role in rice cell wall biology and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.