Recombinant Oryza sativa subsp. japonica Protein disulfide isomerase-like 5-2 (PDIL5-2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Protein Disulfide Isomerase-Like 5-2 (PDIL5-2)

Protein Disulfide Isomerases (PDIs) are a family of endoplasmic reticulum (ER) resident proteins that catalyze the formation, breakage, and rearrangement of disulfide bonds between cysteine residues in client proteins. These enzymes are crucial for proper protein folding, quality control, and trafficking within the cell . In plants, the PDI family is diverse, with members exhibiting variations in domain architecture, subcellular localization, and function .

Oryza sativa subsp. japonica, commonly known as rice, contains multiple PDI isoforms, including Protein Disulfide Isomerase-Like 5-2 (PDIL5-2). PDIL5-2 belongs to a specific PDI subfamily, exhibiting a characteristic domain arrangement and playing a distinct role in plant cells .

Functional Roles and Significance

PDIL5-2 plays a crucial role in protein folding and quality control within the endoplasmic reticulum (ER) of rice cells . As a PDI, it facilitates the correct folding of proteins by catalyzing the formation and isomerization of disulfide bonds . This is particularly important for seed storage proteins, ensuring they attain their functional conformation and are properly exported from the ER .

PDIL5-2 contributes to the plant's response to ER stress . ER stress occurs when unfolded or misfolded proteins accumulate in the ER, triggering the unfolded protein response (UPR) . PDIL5-2, along with other ERAD components, helps to alleviate ER stress by facilitating the degradation of misfolded proteins .

Research Findings and Experimental Data

Several studies have investigated the role and function of PDIL5-2 in rice and other plant species. For example, research has shown that PDIL1-1, another PDI isoform in rice, is involved in creating disulfide bonds between glutelin subunits, which is essential for protein folding and ER export . While PDIL5-2 has a different structure, this highlights the importance of PDIs in protein processing.

Experiments involving the overexpression or suppression of ERAD components in rice have demonstrated the importance of these proteins in maintaining ER homeostasis and seed development . These studies often utilize techniques such as SWATH-based quantitative proteomic analysis, coimmunoprecipitation, and mutant analysis to elucidate the function of PDIL5-2 and its interacting partners .

Future Directions and Perspectives

Further research is needed to fully elucidate the specific functions of PDIL5-2 in rice. Future studies could focus on:

  • Identifying specific client proteins of PDIL5-2: Determining which proteins PDIL5-2 interacts with and assists in folding will provide insights into its specific roles in different cellular processes.

  • Investigating the regulation of PDIL5-2 gene expression: Understanding how the expression of PDIL5-2 is regulated under different developmental and stress conditions will help elucidate its role in plant adaptation.

  • Analyzing the impact of PDIL5-2 mutations: Creating and analyzing PDIL5-2 knockout or knockdown mutants will reveal the phenotypic consequences of its loss of function, providing further insights into its biological significance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
PDIL5-2; PDIL7-1; Os04g0432500; LOC_Os04g35290; OSJNBa0084A10.17; Protein disulfide isomerase-like 5-2; OsPDIL5-2; Protein disulfide isomerase-like 7-1; OsPDIL7-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-423
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PDIL5-2
Target Protein Sequence
EEFPRDGRVIELDESSFEAALGAIDYLFVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPI IVAKVNADKYRKLGSKYGVDGFPTLMLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVSIL ESDSAIKSFVENAGTSFPMFIGFGVNESLIAGYGGKYKKRAWFAVAKDFSEDFMVTYDFD KVPALVSLHPKYKEQSVFYGPFEGSFLEDFIRQSLLPLTVPINTETLKMLDDDDRKVVLA ILEDDSDETSSQLVKVLRSAANANRDLVFGYVGIKQWDEFVETFDISKSSQLPKLIVWDR NEEYEVVEGSEKLEEGDQASQISQFLEGYRAGRTTKKKVSGPSFMGFLNSLVSLNSLYIL ICVFALLGVMIYFTGQDDTPQVRRAHEE
Uniprot No.

Target Background

Function
Recombinant Oryza sativa subsp. japonica Protein disulfide isomerase-like 5-2 (PDIL5-2) acts as a protein-folding catalyst. It interacts with nascent polypeptides, catalyzing the formation, isomerization, and reduction/oxidation of disulfide bonds. It may also play a role in storage protein biogenesis.
Database Links

KEGG: osa:4335881

STRING: 39947.LOC_Os04g35290.1

UniGene: Os.9630

Protein Families
Protein disulfide isomerase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental designs are most appropriate for studying PDIL5-2 loss-of-function in rice?

For investigating PDIL5-2 function through loss-of-function approaches, researchers should consider a combination of formal experimental designs:

  • Completely Randomized Design (C.R. Design): This design incorporates the principles of replication and randomization, where rice plants with PDIL5-2 mutations and wild-type controls are randomly assigned to treatments . This approach is suitable for initial screening experiments.

  • Randomized Block Design (R.B. Design): An improvement over C.R. Design that applies the principle of local control alongside replication and randomization. Plants are divided into blocks to control for environmental variations within a greenhouse or field setting .

  • Before-and-after with control design: For studying dynamic processes like virus infection, this design measures the dependent variable in both test (PDIL5-2 mutant) and control (wild-type) plants before and after pathogen introduction . The treatment effect is calculated by comparing the changes in both groups.

For virus resistance studies specifically, mechanical inoculation followed by ELISA analysis of 5-8 plants per genotype is recommended, with infection rate (%) serving as the quantitative measurement for subsequent statistical analysis .

How should researchers approach CRISPR-Cas9 editing of PDIL5-2 in rice for functional studies?

Based on successful CRISPR-Cas9 editing of PDIL5-1 in barley, the following methodological workflow is recommended for rice PDIL5-2:

  • Target site selection: Identify conserved functional domains in PDIL5-2 using sequence alignment with barley PDIL5-1. Design multiple gRNAs targeting different motifs, as mutations in different target regions can produce varied resistance phenotypes .

  • Transformation protocol: Use Agrobacterium-mediated transformation of rice calli, with selection based on antibiotic resistance markers.

  • Mutation screening methodology:

    • Amplify target regions using PCR

    • Perform direct sequencing of PCR products

    • Analyze using customized bioinformatics tools to detect indels and SNPs

    • Pay special attention to microhomologies in target regions that may influence mutation patterns

  • Progeny analysis: Generate homozygous mutants by selfing primary transformants and select transgene-free progeny in the M2 generation.

  • Phenotypic characterization: Test mutants for virus resistance using mechanical inoculation and measure agronomic performance to ensure mutations don't negatively affect yield parameters .

How do structural variations in PDIL5-2 correlate with virus resistance mechanisms in rice?

Understanding structure-function relationships in PDIL5-2 requires integrating molecular and phenotypic analyses:

Methodological approach:

  • Generate a library of PDIL5-2 variants using both CRISPR-Cas9 knockout and base editing approaches to create:

    • Frameshift mutations disrupting the entire protein

    • In-frame deletions affecting specific domains

    • Single nucleotide polymorphisms mimicking natural variants

  • Conduct structural analysis using:

    • Homology modeling based on crystallized PDI proteins

    • Molecular dynamics simulations to predict the impact of mutations

    • In vitro protein stability and activity assays

  • Correlate structural changes with resistance phenotypes through:

    • Virus accumulation assays using ELISA

    • Mechanistic studies investigating protein-protein interactions

    • Transcriptomic analysis of defense responses

From studies in barley PDIL5-1, we know that both frameshift mutations and certain in-frame mutations confer resistance to BaMMV . Similar diversity in mutation patterns might be expected for rice PDIL5-2. Researchers should systematically catalog the functional consequences of different mutation types, as illustrated in this representative data table:

Mutation TypeProtein EffectVirus ResistanceGrowth Phenotype
FrameshiftComplete loss of functionHigh resistanceNormal growth expected
Domain deletionPartial loss of functionVariable resistancePotentially normal
SNPAmino acid substitutionAllele-dependentNormal growth expected

Unlike susceptibility factor EIF4E, where knockout negatively impacts yield in barley, PDIL5-1 knockout mutants show no adverse effects on growth and yield under greenhouse conditions . Similar outcomes might be expected for rice PDIL5-2 mutants.

What is the optimal pipeline for QTL analysis to identify PDIL5-2 interactions with other resistance factors?

To investigate how PDIL5-2 interacts with other resistance factors in rice, researchers should implement a comprehensive QTL analysis pipeline:

  • Population development:

    • Create recombinant inbred line (RIL) populations (F6 or beyond) from crosses between resistant and susceptible rice varieties

    • Phenotype 5-8 plants per RIL using ELISA to determine infection rates

  • Genotyping approach:

    • Employ RNA-Seq to identify polymorphisms between parents

    • Filter for high-quality SNPs with homozygous read depth ≥2

    • Map sequences to reference genomes with criteria of 95% identity and 90% coverage

    • Design genotyping assays using platforms like Fluidigm 96.96 Dynamic Array

  • Linkage map construction:

    • Use software like JoinMap v4.1 with appropriate population model settings

    • Set LOD threshold to 4.0 for robust linkage group determination

  • QTL analysis:

    • Perform composite interval mapping using forward and backward methods

    • Determine genome-wide LOD threshold at 0.05 significance level using 1,000 permutations

    • Identify epistatic interactions between PDIL5-2 and other loci

  • Validation and functional analysis:

    • Develop near-isogenic lines for specific QTLs

    • Apply candidate gene strategy integrating linkage map, expression profile, and functional complementation analyses

    • Evaluate the effect of combining PDIL5-2 resistance with other QTLs

This methodology has proven successful in identifying disease resistance QTLs in rice against bacterial blight and fungal blast , and can be adapted for studying virus resistance involving PDIL5-2.

How can transcriptome analysis be optimized to understand PDIL5-2 regulatory networks during pathogen infection?

To decipher the regulatory networks involving PDIL5-2 during pathogen challenge, researchers should implement the following RNA-Seq based approach:

  • Experimental design:

    • Implement a before-and-after with control design

    • Include wild-type, PDIL5-2 knockout, and PDIL5-2 overexpression lines

    • Sample at multiple time points (0, 12, 24, 48, 72, 96 hours post-inoculation)

    • Use biological triplicates for statistical robustness

  • RNA extraction and sequencing:

    • Extract high-quality RNA using TRIzol or similar methods

    • Perform quality control using Bioanalyzer (RIN > 8.0)

    • Generate stranded mRNA libraries with 150bp paired-end sequencing

    • Aim for >20 million reads per sample

  • Bioinformatic analysis pipeline:

    • Process raw data with Trimmomatic to remove low-quality sequences

    • Map to reference genome using STAR or HISAT2

    • Quantify expression using featureCounts or Salmon

    • Identify differentially expressed genes using DESeq2 or edgeR

    • Perform pathway enrichment and gene network analysis

  • Validation and functional characterization:

    • Confirm key findings using RT-qPCR

    • Validate protein-protein interactions using co-immunoprecipitation

    • Investigate transcription factor binding using ChIP-seq

    • Confirm regulatory relationships using gene silencing or overexpression

This approach can reveal how PDIL5-2 expression correlates with defense response pathways and identify potential targets for enhancing disease resistance in rice.

What methods are most effective for analyzing PDIL5-2 interactions with viral proteins in rice?

To investigate PDIL5-2 interactions with viral proteins, researchers should employ a multi-faceted approach:

  • In vitro interaction studies:

    • Express and purify recombinant PDIL5-2 and viral proteins

    • Perform pull-down assays to confirm direct interactions

    • Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics

    • Apply hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • In vivo interaction analysis:

    • Implement bimolecular fluorescence complementation (BiFC) in rice protoplasts

    • Perform co-immunoprecipitation from infected plant tissues

    • Use proximity labeling methods (BioID or TurboID) to identify interaction partners

    • Apply fluorescence resonance energy transfer (FRET) to confirm interactions in living cells

  • Structural studies:

    • Determine protein structures using X-ray crystallography or cryo-EM

    • Model interaction interfaces using computational approaches

    • Validate key interaction residues through site-directed mutagenesis

  • Functional validation:

    • Test the impact of disrupting specific interactions on virus replication

    • Create chimeric PDIL proteins to map functional domains required for virus interaction

    • Develop competitors or inhibitors of the interaction as potential disease control tools

This systematic approach will help elucidate how PDIL5-2 functions as a susceptibility factor and may reveal novel strategies for engineering virus resistance in rice.

How does PDIL5-2 compare functionally with homologous proteins in other economically important crops?

For comparative functional analysis of PDIL5-2 across crop species, researchers should implement:

  • Phylogenetic analysis:

    • Collect PDIL sequences from diverse crop species

    • Perform multiple sequence alignment using ClustalW

    • Construct phylogenetic trees using maximum likelihood methods

    • Calculate branch support with 1,000 bootstrap replicates

  • Domain structure comparison:

    • Analyze conserved functional domains and catalytic sites

    • Identify species-specific variations in key regions

    • Map known resistance-conferring mutations across species

  • Expression pattern analysis:

    • Compare tissue-specific and stress-induced expression patterns

    • Analyze promoter regions for conserved regulatory elements

    • Conduct cross-species transcriptome comparisons during pathogen infection

  • Functional complementation studies:

    • Express PDIL5-2 homologs from different species in model plants

    • Test for restoration of susceptibility in resistant backgrounds

    • Evaluate cross-species compatibility of resistance mechanisms

In barley, PDIL5-1-based virus resistance has been reported, while this resistance mechanism has not been documented in other species despite the high conservation of this gene throughout eukaryotes . This suggests species-specific interactions with viral pathogens that merit detailed investigation to understand how these highly conserved proteins develop specialized roles in different crop species.

What breeding strategies can effectively incorporate PDIL5-2-mediated resistance into elite rice varieties?

To integrate PDIL5-2-mediated resistance into elite rice varieties, researchers should employ a combination of conventional and molecular breeding approaches:

  • Gene editing strategy:

    • Apply CRISPR-Cas9 to directly modify PDIL5-2 in elite varieties

    • Generate multiple allelic variants (both knockout and specific SNPs)

    • Select transgene-free homozygous mutants in the M2 generation

    • Evaluate resistance spectrum against multiple virus strains

  • Marker-assisted selection:

    • Develop perfect markers linked to resistant PDIL5-2 alleles

    • Implement foreground selection for the resistant allele

    • Use background selection to recover the recurrent parent genome

    • Apply genome-wide markers to minimize linkage drag

  • Resistance pyramiding strategy:

    • Combine PDIL5-2-mediated resistance with other resistance mechanisms

    • Target different viral components with multiple resistance genes

    • Pyramid two or three minor QTL genes functioning in different defense pathways

    • Test for potential negative epistatic interactions

  • Field evaluation protocol:

    • Establish multi-location trials in virus hotspots

    • Implement appropriate experimental designs (Randomized Block Design)

    • Assess both resistance phenotype and agronomic performance

    • Evaluate durability under diverse environmental conditions

Gene editing offers significant advantages over conventional breeding by avoiding the linkage drag associated with introgression from landraces or wild relatives. This approach has been successfully demonstrated with PDIL5-1 in barley, where CRISPR-edited lines showed resistance to BaMMV without compromising yield .

How can systems biology approaches enhance our understanding of PDIL5-2 in the broader context of rice immunity?

To place PDIL5-2 within the broader context of rice immunity networks, researchers should implement integrated systems biology approaches:

  • Multi-omics integration strategy:

    • Combine transcriptomics, proteomics, metabolomics, and interactomics data

    • Apply network inference algorithms to identify regulatory hubs

    • Use Bayesian network analysis to predict causal relationships

    • Integrate temporal data to understand dynamic responses

  • Comparative systems analysis:

    • Compare PDIL5-2 networks in resistant and susceptible genotypes

    • Analyze network rewiring during pathogen infection

    • Identify conserved and divergent modules across different rice varieties

    • Evaluate cross-talk between viral, bacterial, and fungal defense pathways

  • Mathematical modeling:

    • Develop ordinary differential equation models of key regulatory pathways

    • Perform sensitivity analysis to identify critical control points

    • Simulate perturbations to predict system behavior

    • Validate model predictions experimentally

  • Translational applications:

    • Identify additional targets for resistance engineering

    • Predict potential trade-offs between resistance and yield

    • Design optimal combinations of resistance mechanisms

    • Develop biosignatures for rapid resistance phenotyping

This systems-level understanding can guide more efficient breeding strategies, particularly for combining PDIL5-2-mediated resistance with other defense mechanisms. The integration of minor QTLs functioning in different defense pathways has proven effective for creating highly resistant rice cultivars against bacterial blight and blast diseases , and similar approaches could be applied for viral resistance involving PDIL5-2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.