Recombinant Oryza sativa subsp. japonica Protein disulfide isomerase-like 5-3 (PDIL5-3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Protein Disulfide Isomerase-Like 5-3 (PDIL5-3)

Oryza sativa subsp. japonica Protein Disulfide Isomerase-Like 5-3 (PDIL5-3) is a protein belonging to the protein disulfide isomerase (PDI) family, which are molecular chaperones involved in the formation and rearrangement of disulfide bonds in proteins . PDIL5-3, specifically, is found in rice (Oryza sativa) . Recombinant PDIL5-3 refers to the protein that has been produced using recombinant DNA technology, typically in a host organism like E. coli .

Gene Information and Characteristics

The gene encoding PDIL5-3 is also known by the synonyms PDIL7-2, Os02g0550300, LOC_Os02g34530, OsJ_07093, OsPDIL5-3, and OsPDIL7-2 . It is located on chromosome 2 of Oryza sativa subsp. japonica . The full-length mature protein consists of 425 amino acids, but the recombinant form often includes only amino acids 29-425 .

Table 1: Characteristics of Recombinant PDIL5-3

CharacteristicDescription
SpeciesRice
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (29-425)
FormLyophilized powder
Amino Acid SequenceADAGGGGEAEEFQIPRDGRVLELDDGNFDAAVRAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLAGLSTPIVVAKVNADKYKKLGSKYGVDGFPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDVSVLESDSAIKSFVEDAGMGFPLFLGFGVDESLIVEYGAKYKNRAWFSVAKDFSEDMMVFYDFDKVPALVSVNPKYREQSIFYGPFDDGAFLEDFIRNSLLPLVVPMNRETVKMLNDDGRKVVLMILQDDESDENSPRLIKVLRSAASANRDLVFGYVGVNQWEEFTETFDVKSSELPTMIVWDKKEEYEIVEGSERLEEGDYGSQISRFLEGYRAGRTIKKKVGDRSPTLLGVNAVYILVFLVAVLVLLMYFSGQGEEDQRPRQRAHED
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.
UniProt IDQ0E0I1

Potential Applications

Recombinant PDIL5-3 can be utilized in various research and biotechnological applications:

  • Protein Folding Studies: Recombinant PDIL5-3 can be used in in vitro assays to study the mechanisms of protein folding and the effects of PDIs on the folding process.

  • Drug Discovery: Given the importance of proper protein folding in cellular function, PDIL5-3 may be a potential target for drug discovery, particularly for diseases related to protein misfolding or ER stress.

  • Biotechnology: Recombinant PDIL5-3 could be employed to improve the production of recombinant proteins in heterologous expression systems by enhancing protein folding and stability.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.

Synonyms
PDIL5-3; PDIL7-2; Os02g0550300; LOC_Os02g34530; OsJ_07093; Protein disulfide isomerase-like 5-3; OsPDIL5-3; Protein disulfide isomerase-like 7-2; OsPDIL7-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-425
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
PDIL5-3
Target Protein Sequence
ADAGGGGEAEEFQIPRDGRVLELDDGNFDAAVRAAGLLFVDFYAPWCGHCKRLAPQLDEA APVLAGLSTPIVVAKVNADKYKKLGSKYGVDGFPTLMLFDHGTPTEYTGSRKADLLVENL KKLVAPDVSVLESDSAIKSFVEDAGMGFPLFLGFGVDESLIVEYGAKYKNRAWFSVAKDF SEDMMVFYDFDKVPALVSVNPKYREQSIFYGPFDDGAFLEDFIRNSLLPLVVPMNRETVK MLNDDGRKVVLMILQDDESDENSPRLIKVLRSAASANRDLVFGYVGVNQWEEFTETFDVK SSELPTMIVWDKKEEYEIVEGSERLEEGDYGSQISRFLEGYRAGRTIKKKVGDRSPTLLG VNAVYILVFLVAVLVLLMYFSGQGEEDQRPRQRAHED
Uniprot No.

Target Background

Function

Recombinant Oryza sativa subsp. japonica Protein disulfide isomerase-like 5-3 (PDIL5-3) acts as a protein-folding catalyst. It interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction/oxidation of disulfide bonds. It may also play a role in storage protein biogenesis.

Database Links
Protein Families
Protein disulfide isomerase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • How does PDIL5-3 compare to other PDI family members in rice?

    Rice contains multiple PDI and PDI-like proteins that play roles in protein folding and quality control. While specific comparative analysis of PDIL5-3 with other rice PDIs is limited in the provided information, PDI proteins in plants are generally categorized into different groups based on their domain architecture .

    Based on the broader plant PDI classification:

    • Group I PDIs (like PDIL1-1) typically have two active thioredoxin domains

    • Group IV proteins may lack a KDEL sequence (ER retention signal) but still localize to the ER

    • PDIL5-3 belongs to a group that contains thioredoxin-like domains involved in disulfide bond formation

    Unlike some other PDI family members (such as PDIL1-1 which affects rice flour properties when mutated ), direct functional characteristics specific to PDIL5-3 are not extensively described in the provided research.

  • What expression systems are used for producing recombinant PDIL5-3?

    Recombinant PDIL5-3 is primarily produced in E. coli expression systems as shown in multiple commercial sources . For research applications, the recombinant protein is typically:

    • Expressed with a His-tag for purification purposes

    • Provided as lyophilized powder or in buffer with preservatives (often containing glycerol)

    • Stored at -20°C/-80°C for long-term storage, with working aliquots kept at 4°C

    • Reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL prior to use

    For optimal activity, freezing and thawing cycles should be minimized, and the protein is often aliquoted with 5-50% glycerol as a cryoprotectant .

Intermediate Research Applications

  • What methods are used to assess PDIL5-3 function in rice?

    While the search results don't provide specific protocols for PDIL5-3 functional analysis, studies on related PDI proteins suggest several experimental approaches applicable to PDIL5-3 research:

    • Gene expression analysis: RT-PCR or RNA-seq to quantify expression levels under various stress conditions (particularly ER stress)

    • Subcellular localization: Fusion with fluorescent proteins (like YFP) to track protein localization within cells

    • Knockout/knockdown studies: Using RNAi or CRISPR-Cas9 to generate loss-of-function mutants and assess phenotypic changes

    • Protein-protein interactions: Co-immunoprecipitation (Co-IP) experiments to identify interacting partners

    • Enzymatic activity assays: Measuring disulfide isomerase activity using fluorescent substrates

    For example, OsDER1 (an ER-associated protein involved in protein degradation) was studied using transgenic rice lines with overexpression or suppression of the gene, followed by analysis of phenotypic changes and protein interactions .

  • How might post-translational modifications affect PDIL5-3 function?

    PDI family proteins typically undergo various post-translational modifications that impact their function. For PDIL5-3 specifically:

    • Disulfide bond formation: As a disulfide isomerase, PDIL5-3 likely contains catalytic cysteines that cycle between oxidized and reduced states during enzymatic activity

    • Glycosylation: Potential N-linked glycosylation may affect protein stability and function

    • ER retention: While some PDI proteins contain KDEL sequences for ER retention, others may utilize different mechanisms for proper localization

    When working with recombinant PDIL5-3, researchers should consider whether these modifications are present or needed for functional studies, as bacterial expression systems may lack some post-translational modifications found in plant cells.

  • How do experimental conditions affect PDIL5-3 stability and activity?

    Based on general information about PDI proteins and recombinant protein handling:

    • pH sensitivity: PDI proteins typically show optimal activity at slightly acidic to neutral pH (6.5-7.5)

    • Temperature effects: Store recombinant PDIL5-3 at -20°C/-80°C for long-term storage; working aliquots are stable at 4°C for approximately one week

    • Buffer composition: Tris/PBS-based buffers with 6% trehalose at pH 8.0 are recommended for storage

    • Reducing agents: The presence of reducing agents like DTT or β-mercaptoethanol can affect the redox state of PDIL5-3's catalytic cysteines

    • Reconstitution protocol: It's recommended to centrifuge the vial before opening, reconstitute in deionized water to 0.1-1.0 mg/mL, and add glycerol (5-50% final concentration) before aliquoting for storage

Advanced Research Questions

  • How does PDIL5-3 function in the unfolded protein response pathway in rice?

    While specific roles of PDIL5-3 in the unfolded protein response (UPR) are not detailed in the search results, insights can be drawn from related PDI family members:

    • PDI proteins are often upregulated during ER stress as part of the UPR

    • In rice, manipulation of other ER quality control components (like OsDER1) leads to UPR activation and hypersensitivity to ER stress

    • Experimental approaches to investigate PDIL5-3's role in UPR could include:

      • Measuring expression levels under various ER stressors (tunicamycin, DTT)

      • Analyzing phenotypes of PDIL5-3 overexpression or suppression lines under stress conditions

      • Examining interactions with known UPR components (BiP, IRE1)

      • Assessing changes in downstream UPR markers when PDIL5-3 is manipulated

    For comprehensive UPR pathway analysis, researchers should consider combining transcriptomics, proteomics, and phenotypic analyses of transgenic plants with modified PDIL5-3 expression .

  • What is the potential role of PDIL5-3 in pathogen resistance based on studies of related PDI proteins?

    Studies of related PDI proteins, particularly PDIL5-1 in barley, provide insights into potential pathogen resistance functions:

    • PDIL5-1 in barley serves as a susceptibility factor for Bymoviruses (BaYMV and BaMMV), with mutations conferring resistance to these pathogens

    • Non-functional PDIL5-1 variants in barley provide resistance to multiple viral strains without affecting plant development or yield

    • CRISPR/Cas9-mediated editing of PDIL5-1 in susceptible barley cultivars successfully created virus-resistant plants

    To investigate whether PDIL5-3 has similar roles in rice:

    1. Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

    2. Challenge plants with various rice pathogens (particularly viruses)

    3. Assess resistance phenotypes and analyze mechanisms

    4. Compare protein sequences between PDIL5-1 and PDIL5-3 to identify conserved domains potentially involved in pathogen interactions

  • How does genetic background influence PDIL5-3 function compared to other PDI family members?

    The influence of genetic background on PDI function is demonstrated by studies of PDIL1-1:

    • When a deficient PDIL1-1 mutant allele was introduced into different rice cultivars (Koshihikari and Oonari), the effects on rice flour characteristics and food processing properties varied significantly between genetic backgrounds

    • Despite similar seed storage protein accumulation, only one genetic background showed improvements in flour quality and food processing properties

    For PDIL5-3 research, this suggests:

    • The need to evaluate PDIL5-3 functions across multiple genetic backgrounds

    • Importance of analyzing gene expression networks that might differ between cultivars

    • Consideration of potential epistatic interactions with other genes

    • Design experiments with appropriate controls from the same genetic background

    • Include multiple cultivars when assessing phenotypic effects of PDIL5-3 manipulation

  • What methodological approaches are most effective for studying PDIL5-3 interactions with other proteins?

    To investigate PDIL5-3 interactions with other proteins, researchers can employ several complementary approaches:

    In vitro methods:

    • Pull-down assays using His-tagged recombinant PDIL5-3

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic analysis

    In vivo methods:

    • Co-immunoprecipitation with PDIL5-3-specific antibodies

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

    • Yeast two-hybrid screening to identify novel interacting partners

    • Proximity-dependent biotin identification (BioID) for capturing transient interactions

    For example, OsDER1 interactions with OsHRD1, OsHRD3, and OsCDC48 were demonstrated using co-immunoprecipitation experiments, revealing its role in the endoplasmic reticulum-associated protein degradation (ERAD) pathway .

  • How can CRISPR/Cas9 genome editing be effectively utilized to study PDIL5-3 function?

    CRISPR/Cas9 genome editing has been successfully used to study PDI family proteins, particularly in creating virus-resistant barley through PDIL5-1 editing . For PDIL5-3 functional studies, researchers can apply similar approaches:

    Experimental design considerations:

    • Target specific domains (e.g., thioredoxin domains) or the entire gene

    • Design sgRNAs following established rules (e.g., 5'-20NGG-3') with minimal off-target potential

    • Use appropriate vectors (e.g., containing Cas9 driven by a strong promoter and selectable markers)

    • Transform plant tissues via Agrobacterium-mediated transformation

    Analysis of edited plants:

    • Confirm edits by sequencing the target region

    • Classify mutations (frameshift, in-frame deletions, substitutions)

    • Assess protein presence/absence via Western blotting

    • Characterize phenotypes under normal and stress conditions

    • Evaluate agronomic traits to identify any yield penalties

    Advanced applications:

    • Create specific amino acid substitutions to study structure-function relationships

    • Generate conditional knockouts using inducible systems

    • Edit multiple PDI family members simultaneously to address functional redundancy

  • How do post-transcriptional regulatory mechanisms affect PDIL5-3 expression?

    Post-transcriptional regulation could significantly impact PDIL5-3 expression and function, though specific mechanisms for PDIL5-3 are not detailed in the search results. Based on studies of other plant proteins:

    Potential regulatory mechanisms to investigate:

    1. Alternative splicing - Analyze RNA-seq data to identify potential splice variants

    2. miRNA regulation - Search for miRNA binding sites in the PDIL5-3 transcript

    3. RNA stability - Measure transcript half-life under different conditions

    4. Translational control - Perform polysome profiling to assess translation efficiency

    Experimental approaches:

    • RNA-seq under different conditions to detect alternative splicing events

    • 5' and 3' RACE to map transcript boundaries

    • RNA immunoprecipitation to identify RNA-binding proteins that interact with PDIL5-3 mRNA

    • In vitro translation assays to study translational regulation

    • Reporter constructs with PDIL5-3 UTRs to assess regulatory elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.