Recombinant Oryza sativa subsp. japonica Putative magnesium transporter MRS2-D (MRS2-D)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa subsp. japonica Putative Magnesium Transporter MRS2-D (MRS2-D)

Oryza sativa subsp. japonica Putative Magnesium Transporter MRS2-D (MRS2-D) is a protein involved in magnesium ion transport in Oryza sativa (Japanese rice) . MRS2-D is encoded by the gene LOC107275769 . It is a putative magnesium transporter, meaning it is believed to transport magnesium, but this function has not been definitively proven . The full-length protein consists of 434 amino acids .

Table 1: Key Properties of Recombinant Oryza sativa subsp. japonica Putative Magnesium Transporter MRS2-D (MRS2-D)

PropertyDescription
Gene SymbolLOC107275769
Full NamePutative magnesium transporter MRS2-D
OrganismOryza sativa Japonica Group (Japanese rice)
Protein Length434 amino acids
SynonymsMRS2-D, Os04g0430900, LOC_Os04g35160, OsJ_14848, OSJNBa0084A10.4
UniProt IDQ7XQQ1
AA SequenceMAARRRHVAAGAGAPAPAAGEWAAVTAGGGAAWALSPVEEVGTKQELMRRTGLPPRDLRA LDPALSSAASASSCRPSAITGRDRAVVVNLDRARAVITASEVLVPSPRDPAVAPLVRELR ARLALAASPTPAPSPSPPQHGMAVGMDGSISPSQASRGGEEAAGNGKDGEALGGGDKALP FEFRALEVCLEFACKSLEHETCTLEKEAYPALDELTSKVSTLNLERVRQIKSRLVAISGK VQKVRDELEHLLDDDMDMAALHLTEKLAYQSSRFDIDKEASELEDHSSRDEEGVEGGGGG DGDDETIAGGGSFSPNTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQ NQLLQMGILLSTGTLVSSCAIAVTGVFGINVHISLYDSPASSAAFPCAAAGIVAGSLALY LAALLCYKRAGILQ
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Expression Region1-434

Function and Significance

MRS2-D belongs to the MRS2/MgtE family of magnesium transporters . Magnesium is an essential nutrient for plant growth and development, playing critical roles in various cellular processes, including photosynthesis, enzyme activation, and protein synthesis .

The transport of magnesium ions is crucial for maintaining cellular magnesium homeostasis, which is essential for plant health and productivity . While MRS2-D is annotated as a "putative" transporter, the MRS2 family, in general, is known to function in magnesium transport. For example, the human mitochondrial MRS2 protein (unrelated to MRS2-D) has been shown to transport magnesium ions across mitochondrial inner membranes, which is critical for mitochondrial function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2-D; Os04g0430900; LOC_Os04g35160; OsJ_14848; OSJNBa0084A10.4; Putative magnesium transporter MRS2-D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-434
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MRS2-D
Target Protein Sequence
MAARRRHVAAGAGAPAPAAGEWAAVTAGGGAAWALSPVEEVGTKQELMRRTGLPPRDLRA LDPALSSAASASSCRPSAITGRDRAVVVNLDRARAVITASEVLVPSPRDPAVAPLVRELR ARLALAASPTPAPSPSPPQHGMAVGMDGSISPSQASRGGEEAAGNGKDGEALGGGDKALP FEFRALEVCLEFACKSLEHETCTLEKEAYPALDELTSKVSTLNLERVRQIKSRLVAISGK VQKVRDELEHLLDDDMDMAALHLTEKLAYQSSRFDIDKEASELEDHSSRDEEGVEGGGGG DGDDETIAGGGSFSPNTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQ NQLLQMGILLSTGTLVSSCAIAVTGVFGINVHISLYDSPASSAAFPCAAAGIVAGSLALY LAALLCYKRAGILQ
Uniprot No.

Target Background

Function
Putative magnesium transporter.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MRS2-D and to which protein family does it belong?

MRS2-D (Putative magnesium transporter MRS2-D) is a member of the CorA/MGT/MRS2-type membrane protein superfamily from Oryza sativa subsp. japonica (rice). This protein family is characterized by a distinctive GMN tripeptide motif (Gly-Met-Asn) located at the end of the first of two C-terminal transmembrane domains . MRS2-D is specifically encoded by the gene Os04g0430900 (LOC_Os04g35160) and consists of 434 amino acids in its full-length form . The protein functions as a transmembrane transporter primarily involved in magnesium (Mg²⁺) uptake and homeostasis in plants, playing crucial roles in various physiological processes including photosynthesis, enzyme activation, and stress responses .

How is the structure of MRS2-D characterized compared to other family members?

MRS2-D belongs to the CorA-like structural clade of magnesium transporters. Its structure differs significantly from prokaryotic orthologs like CorA. While maintaining the characteristic GMN motif, MRS2-D exhibits specific structural features:

  • Contains an α/β domain with a six-stranded β-sheet and two α-helices, in contrast to the seven-stranded β-sheet with four α-helices observed in CorA

  • Features transmembrane domains responsible for ion channel formation

  • Has a specific amino acid sequence that contributes to its selective permeability properties

  • Exhibits a different topology and structural arrangement from prokaryotic homologs, which may contribute to its specific ion selectivity and regulation mechanisms

The contrasting α/β domain structure and assembly interface suggest that MRS2-D may employ a distinct gating mechanism from that of its prokaryotic counterparts .

What is known about the expression patterns of MRS2-D in rice?

While the search results don't provide specific expression data for MRS2-D, studies on the broader MRS2/MGT gene family in various plants reveal tissue-specific and developmentally regulated expression patterns. Based on related research:

  • MRS2/MGT family members show highly differentiated tissue-specific expression patterns

  • Several rice MGT genes demonstrate distinct expression patterns under various developmental stages and in response to environmental stresses

  • Expression analysis of OsMGT genes in various tissues suggests these genes may possess critical functions during rice development

  • Expression patterns may be regulated by stress-responsive cis-elements present in the promoter regions of MGT genes

For precise expression analysis of MRS2-D, researchers typically employ RT-qPCR to analyze transcript levels across different tissues and under various environmental conditions, as has been done with other MGT family members .

How do experimental designs for studying MRS2-D function compare across different model systems?

Studying MRS2-D function typically employs complementary experimental designs across different model systems:

A. Yeast Complementation Systems:

  • Utilize Saccharomyces cerevisiae mrs2 mutants lacking functional magnesium transport

  • Transform mutants with MRS2-D constructs to assess functional complementation

  • Evaluate growth on non-fermentable medium (e.g., YPdG with glycerol as carbon source)

  • Measure direct Mg²⁺ uptake using fluorescent dyes like mag-fura-2

B. Bacterial Systems:

  • Employ Salmonella typhimurium mutants deficient in magnesium transport

  • Transform with MRS2-D constructs to assess restoration of transport function

  • Analyze growth under magnesium-limited conditions

C. Plant-Based Systems:

  • Generate homozygous T-DNA insertion knockout lines in rice

  • Develop overexpression lines using suitable promoters

  • Employ CRISPR/Cas9 for precise gene editing

  • Analyze phenotypes under varying magnesium concentrations and stress conditions

  • Perform cross-species complementation experiments

D. Statistical Analysis Approaches:

  • Apply experimental designs such as Completely Randomized Design (CRD), Randomized Blocks Design (RBD), or factorial designs

  • Analyze data using ANOVA and appropriate post-hoc tests

  • Consider using R packages like ExpDes for specialized experimental design analysis

Experimental SystemAdvantagesLimitationsKey Measurements
Yeast Complementation- Simple system for functional analysis
- Direct measurement of Mg²⁺ uptake
- Well-established protocols
- Foreign membrane environment
- May not reflect plant-specific regulation
- Growth on non-fermentable media
- Mag-fura-2 fluorescence
- Mitochondrial Mg²⁺ content
Bacterial Systems- Rapid assessment of transport function
- Simple genetic manipulation
- Evolutionary distance from plants
- Different membrane composition
- Growth curves
- Mg²⁺ uptake assays
Plant Systems- Native cellular environment
- Relevant physiological context
- Tissue-specific analysis
- Complex genetic background
- Longer experimental timelines
- Functional redundancy
- Phenotypic analysis
- Tissue Mg²⁺ content
- Gene expression analysis
- Stress responses

What methodological approaches are most effective for analyzing MRS2-D ion selectivity and transport kinetics?

Analysis of MRS2-D ion selectivity and transport kinetics requires specialized techniques:

A. Direct Measurement of Ion Transport:

  • Employ the mag-fura-2 fluorescent dye system for real-time Mg²⁺ uptake measurement

  • Use radioactive isotopes (²⁵Mg) for short-term uptake experiments

  • Perform membrane potential measurements to assess electrophysiological properties

  • Apply patch-clamp techniques to characterize channel properties

B. Ion Competition Assays:

  • Test transport in the presence of competing ions (Ca²⁺, Ba²⁺, Sr²⁺)

  • Analyze rescue effects by different ions in knockout/mutant systems

  • Determine ion selectivity profiles through competitive inhibition studies

C. Structure-Function Analysis:

  • Generate site-directed mutants of key residues in the ion conduction pathway

  • Create chimeric proteins with domains from other MGT family members

  • Analyze effects of mutations on transport activity and selectivity

  • Correlate structural features with functional properties

D. Advanced Microscopy and Subcellular Localization:

  • Determine subcellular localization using fluorescent protein fusions

  • Apply confocal microscopy to track protein localization

  • Employ transmission electron microscopy with immunogold labeling

  • Use fractionation techniques to isolate membrane compartments

Human MRS2 studies have revealed that it functions as a Ca²⁺-regulated, non-selective channel permeable to Mg²⁺, Ca²⁺, Na⁺, and K⁺, which contrasts with its prokaryotic ortholog CorA . Similar methodologies can reveal whether MRS2-D in rice shares these characteristics or has plant-specific selectivity properties.

How does MRS2-D function under various abiotic stress conditions in rice, and what experimental approaches best capture these responses?

While specific data for MRS2-D is limited in the search results, research on related MGT transporters provides methodological frameworks:

A. Stress Response Analysis:

  • Apply controlled stress conditions (salt, drought, metal toxicity)

  • Monitor gene expression changes via RT-qPCR and RNA-seq

  • Analyze protein accumulation through western blotting

  • Evaluate phenotypic responses in wildtype vs. knockout/overexpression lines

B. Magnesium-Dependent Stress Responses:

  • Compare plant performance under stress with varying Mg²⁺ concentrations

  • Analyze tissue-specific Mg²⁺ accumulation using ICP-MS

  • Measure physiological parameters (photosynthesis, water-use efficiency)

  • Assess oxidative stress markers and antioxidant enzyme activities

C. Metal Stress Interactions:

  • Investigate aluminum (Al) stress responses as shown for OsMGT1

  • Analyze potential cross-talk between Mg²⁺ and Al³⁺ transport

  • Measure root growth and development under metal stress

  • Quantify metal accumulation in different tissues

Research on OsMGT1 has shown that magnesium transporters can be involved in aluminum tolerance, with knockout of OsMGT1 resulting in decreased tolerance to Al, but not to cadmium and lanthanum . The tolerance could be rescued by addition of 10 mM Mg²⁺, but not by the same concentration of barium or strontium, indicating specific Mg²⁺-dependent mechanisms .

What approaches should be used to resolve contradictory data regarding MRS2-D transport capacity across different experimental systems?

Researchers may encounter contradictory data when studying MRS2-D function across different experimental systems. To resolve such contradictions:

A. Standardize Experimental Conditions:

  • Ensure consistent protein expression levels across systems

  • Standardize membrane composition or use native membranes

  • Control for post-translational modifications

  • Normalize transport activity to protein expression levels

B. Consider Temporal Dynamics:

  • Assess transport over different time scales (seconds to hours)

  • Some transporters may show discrepancies between short-term and long-term assays

  • For example, MRS2-3 in Arabidopsis showed low immediate uptake but good complementation in growth assays over longer periods

C. Examine System-Specific Factors:

  • Evaluate effects of heterologous expression systems on protein folding and activity

  • Consider membrane composition differences between yeast, bacteria, and plant cells

  • Assess potential regulatory factors present in one system but absent in another

  • Analyze effects of tagged versus untagged protein versions

D. Apply Integrative Approaches:

  • Combine functional, structural, and computational methods

  • Correlate transport data with structural information

  • Use multiple independent measurement techniques

  • Develop mathematical models to explain system-specific variations

A notable example from the literature describes MRS2-3 in Arabidopsis, which "appeared to complement well in the growth assay but showed magnesium uptake that was not considerably higher than the background mutant level. Possibly, MRS2-3 acts as a comparatively slow transporter for Mg²⁺ (at least in the foreign yeast mitochondrial membrane environment), allowing for ion homeostasis over periods of hours as in the growth assays but not in measurable amounts over shorter time intervals, such as minutes as in the uptake experiments."

What are the optimal conditions for expressing and purifying recombinant MRS2-D protein for structural and functional studies?

Based on the available information about recombinant MRS2-D and related proteins:

A. Expression Systems:

  • E. coli is commonly used for recombinant MRS2-D production as shown in search result

  • BL21(DE3) or Rosetta strains are recommended for membrane protein expression

  • Consider using pET-series vectors with inducible promoters

  • For challenging expressions, consider alternative systems like yeast or insect cells

B. Protein Construct Design:

  • Full-length protein (1-434 amino acids) with N-terminal His-tag has been successfully expressed

  • Consider using truncated constructs removing predicted disordered regions

  • Test multiple tag positions (N-terminal vs. C-terminal)

  • Evaluate different fusion partners (MBP, GST, SUMO) to improve solubility

C. Purification Strategy:

  • Solubilize membrane proteins using appropriate detergents (DDM, LMNG, etc.)

  • Perform initial purification via Ni-NTA affinity chromatography

  • Follow with size exclusion chromatography to achieve high purity

  • Consider ion exchange chromatography as an additional purification step

D. Storage and Handling:

  • Store purified protein at -20°C/-80°C

  • Aliquot to avoid repeated freeze-thaw cycles

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as reported

  • For long-term storage, add 5-50% glycerol (final concentration)

The details from search result provide specific recommendations for recombinant MRS2-D:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol for long-term storage

  • Brief centrifugation prior to opening is recommended

  • Working aliquots can be stored at 4°C for up to one week

What experimental design approaches are most appropriate for studying MRS2-D function in planta?

Effective experimental designs for studying MRS2-D function in rice include:

A. Genetic Manipulation Strategies:

  • Generate knockout mutants using T-DNA insertion or CRISPR/Cas9

  • Create overexpression lines using constitutive (e.g., 35S, Ubiquitin) or tissue-specific promoters

  • Develop complementation lines in knockout backgrounds

  • Design promoter-reporter fusions (GUS, LUC) to study expression patterns

B. Experimental Design Models:

  • Completely Randomized Design (CRD) for controlled growth chamber experiments

  • Randomized Blocks Design (RBD) for greenhouse or field experiments

  • Factorial designs to study interactions between multiple variables (e.g., Mg²⁺ levels × stress conditions)

  • Split-plot designs for experiments with technical limitations

C. Phenotypic Analysis Approaches:

  • Measure growth parameters under varying Mg²⁺ concentrations

  • Assess stress tolerance (salt, drought, metal toxicity)

  • Analyze photosynthetic parameters

  • Evaluate yield components and nutrient use efficiency

D. Molecular Analysis Methods:

  • Employ RT-qPCR for gene expression analysis

  • Use RNA-seq for transcriptome-wide responses

  • Perform Western blotting for protein accumulation

  • Apply ChIP-seq to identify transcription factors regulating MRS2-D

The R package ExpDes provides specialized tools for designing and analyzing these types of experiments, including functions for generating experimental designs and performing appropriate statistical analyses .

How can researchers effectively measure and interpret tissue-specific magnesium distribution mediated by MRS2-D?

To effectively measure and interpret tissue-specific magnesium distribution:

A. Analytical Methods for Mg²⁺ Quantification:

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS) for precise elemental analysis

  • Atomic Absorption Spectroscopy (AAS) for bulk tissue analysis

  • Colorimetric assays using dyes like Eriochrome Black T

  • Stable isotope (²⁵Mg) tracing for uptake and translocation studies

B. Spatial Distribution Analysis:

  • Energy-dispersive X-ray (EDX) microanalysis for cellular localization

  • Synchrotron X-ray fluorescence microscopy for high-resolution mapping

  • Laser ablation ICP-MS for tissue section analysis

  • Histochemical staining with magnesium-specific dyes

C. Temporal Dynamics Assessment:

  • Short-term uptake experiments (30 min) using stable isotope ²⁵Mg as performed with OsMGT1

  • Long-term accumulation studies across developmental stages

  • Pulse-chase experiments to track Mg²⁺ movement between tissues

  • Time-course analysis following stress application or Mg²⁺ resupply

D. Interpretation Framework:

  • Compare wildtype, knockout, and overexpression lines

  • Analyze concentration gradients across tissues and cellular compartments

  • Correlate Mg²⁺ distribution with expression patterns

  • Consider interactions with other ions and transporters

Research on OsMGT1 demonstrated that "a short-term (30 min) uptake experiment with stable isotope ²⁵Mg showed that knockout of OsMGT1 resulted in decreased Mg uptake, but that the uptake in the wild type was enhanced by Al. Mg concentration in the cell sap of the root tips was also increased in the wild-type rice, but not in the knockout lines in the presence of Al." Similar approaches can be applied to study MRS2-D-mediated magnesium distribution.

What are the most promising approaches for elucidating the regulatory network controlling MRS2-D expression and activity?

To elucidate the regulatory network controlling MRS2-D expression and activity:

A. Transcriptional Regulation:

  • Promoter deletion analysis to identify key regulatory elements

  • Yeast one-hybrid screening to identify transcription factors

  • ChIP-seq analysis of candidate transcription factors

  • Analyze cis-acting elements in the promoter region

B. Post-Transcriptional Regulation:

  • Investigate potential microRNA regulation

  • Analyze alternative splicing patterns

  • Assess mRNA stability and turnover rates

  • Study RNA-binding proteins that may influence MRS2-D transcript processing

C. Post-Translational Modifications:

  • Phosphoproteomics to identify potential phosphorylation sites

  • Analyze other PTMs including ubiquitination and SUMOylation

  • Investigate protein-protein interactions using co-immunoprecipitation or yeast two-hybrid

  • Develop antibodies specific to modified forms of MRS2-D

D. Environmental Response Integration:

  • Study expression changes under various abiotic stresses

  • Analyze hormonal regulation of MRS2-D expression

  • Investigate signaling pathways involved in Mg²⁺ sensing

  • Explore cross-talk with other nutrient sensing pathways

Research on OsMGT1 revealed that its expression is regulated by an Al-responsive transcription factor, AL RESISTANCE TRANSCRIPTION FACTOR1 . Similar regulatory mechanisms may control MRS2-D expression, particularly in response to specific environmental stresses or nutrient conditions.

How might structural biology approaches advance our understanding of MRS2-D function and regulation?

Advanced structural biology approaches can significantly enhance our understanding of MRS2-D:

A. Cryo-Electron Microscopy (Cryo-EM):

  • Determine high-resolution structure of MRS2-D

  • Analyze conformational states (open vs. closed)

  • Visualize ion binding sites

  • Investigate structural changes upon ion binding/unbinding

B. X-ray Crystallography:

  • Obtain atomic-resolution structures of soluble domains

  • Analyze protein-ligand interactions

  • Determine structures of transport-critical motifs

  • Study effects of mutations on protein structure

C. Molecular Dynamics Simulations:

  • Model ion permeation pathways

  • Investigate gating mechanisms

  • Predict effects of mutations on function

  • Simulate protein behavior in lipid bilayers

D. Structure-Guided Functional Analysis:

  • Design rational mutations based on structural data

  • Create chimeric proteins to test domain functions

  • Develop structure-based inhibitors or activators

  • Identify conserved vs. species-specific structural features

Studies on human MRS2 have shown significant structural differences from prokaryotic orthologs, including differences in the α/β domain structure and assembly interface that may indicate distinct gating mechanisms . Similar structural investigations of rice MRS2-D could reveal plant-specific features important for its function in agricultural contexts.

What experimental approaches would best address the potential role of MRS2-D in improving crop stress tolerance?

To investigate MRS2-D's potential role in crop stress tolerance:

A. Genetic Engineering Strategies:

  • Develop transgenic rice lines overexpressing MRS2-D

  • Create MRS2-D variants with enhanced transport activity

  • Stack MRS2-D with other stress tolerance genes

  • Generate tissue-specific or stress-inducible expression systems

B. Phenotypic Evaluation Under Stress:

  • Test tolerance to multiple stresses (salt, drought, metal toxicity)

  • Evaluate field performance under stress conditions

  • Measure yield stability across environments

  • Analyze nutrient use efficiency parameters

C. Physiological and Molecular Responses:

  • Monitor photosynthetic parameters under stress

  • Analyze oxidative stress markers and antioxidant systems

  • Perform transcriptome analysis to identify downstream pathways

  • Measure hormonal changes associated with stress responses

D. Integrative Multi-Omics Approaches:

  • Combine transcriptomics, proteomics, and metabolomics

  • Analyze ionome changes under stress conditions

  • Develop predictive models of MRS2-D-mediated stress responses

  • Identify key interaction networks through systems biology

Research has shown that in rice, "OsMGT1 is a transporter for Mg uptake in the roots and that up-regulation of this gene is required for conferring Al tolerance in rice by increasing Mg concentration in the cell." Microarray analysis of OsMGT1 knockout lines showed that "transcripts of genes related to stress were more up- and down-regulated in the knockout lines." Similar approaches could reveal whether MRS2-D plays comparable roles in stress tolerance.

What methodological advances are needed to better understand the interaction of MRS2-D with other membrane transporters and ion channels?

To advance our understanding of MRS2-D interactions with other transporters:

A. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation followed by mass spectrometry

  • Split-ubiquitin yeast two-hybrid for membrane protein interactions

  • Bimolecular fluorescence complementation (BiFC) in planta

  • Förster resonance energy transfer (FRET) microscopy

B. Functional Interaction Analysis:

  • Generate double or triple mutants with related transporters

  • Perform electrophysiological studies in heterologous systems

  • Analyze ion fluxes using ion-selective microelectrodes

  • Develop mathematical models of transporter networks

C. Advanced Imaging Approaches:

  • Super-resolution microscopy to visualize transporter complexes

  • Single-particle tracking to monitor dynamic interactions

  • Live-cell imaging to capture temporal dynamics

  • Correlative light and electron microscopy for multi-scale analysis

D. Systems-Level Investigations:

  • Network analysis of co-expressed transporters

  • Multi-omics integration to identify functional clusters

  • Comparative analysis across species and stress conditions

  • Machine learning approaches to predict functional interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.