Recombinant Oryza sativa subsp. japonica Putative magnesium transporter MRS2-H (MRS2-H)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MRS2-H; Os03g0137700; LOC_Os03g04480; OsJ_09331; Putative magnesium transporter MRS2-H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
MRS2-H
Target Protein Sequence
MALPCAFLSAAAAANATSFSSSPESRRCRSVHRVPSRPRPPLAPPARVMGKGNSKRKAAN TRLWMRLDRRGGCEMILCDKSFVARRSGLPARDLRVLSPLLSRSPSILAREKAMVINLEF VRAIVTADEVLVLEPLAQEVLPFVEKLRKHFPLKSLDVDDVSTHMHTENQDGELAQDVSC YEVEGANHELPFEFQVLDFALEAVCLSYNSTISDLNRSAIAVLDDLMKSVSTRNLERVWS LKSSLTRLLASVQKVRDEVEHILDDNEAMAHLCTARKTKGQKDLLNTILFPETRLCRTHS SIENSTGIRTCVPSDSDAHILDMLLEAYFKQLDGIRNRIFLVRQYIVDTEDYISIQLDNK RNELLGLQLTLIIASFGIAINTFIAAAFAMNIPHRGYHFVIGVPFGQFVGATSFLCMSIV ILLFTYAWRNRLLCT
Uniprot No.

Target Background

Function
Putative magnesium transporter.
Gene References Into Functions
  1. Studies using green fluorescent protein (GFP) expression in isolated rice protoplasts demonstrated chloroplast localization. PMID: 23926064
Database Links

KEGG: osa:4331553

UniGene: Os.52832

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does MRS2-H contribute to magnesium homeostasis in plants?

In plant systems, magnesium transporters of the MRS2/MGT family display varied tissue-specific expression patterns, suggesting specialized roles in different organs and developmental stages. For example, in Arabidopsis, six MRS2/MGT family members are expressed in root tissues, indicating their involvement in magnesium uptake from soil and subsequent distribution throughout the plant . MRS2-7 in Arabidopsis shows expression exclusively in roots, and knockout mutants display magnesium-dependent growth retardation when external Mg²⁺ concentrations are lowered to 50 μM in hydroponic cultures, demonstrating its critical role in plant magnesium nutrition .

What expression systems are optimal for producing recombinant MRS2-H protein?

For recombinant production of MRS2-H protein, E. coli-based expression systems have proven effective. According to available product information, full-length MRS2-H (amino acids 1-435) can be expressed with a His-tag to facilitate purification . The recommended storage conditions for the purified protein include:

  • Storage at -20°C, or -80°C for extended periods

  • Use of Tris-based buffer with 50% glycerol, optimized specifically for this protein

  • Avoiding repeated freeze-thaw cycles, which can compromise protein integrity

  • Storing working aliquots at 4°C for no more than one week

When designing an expression system for MRS2-H, researchers should consider:

  • Codon optimization for the host system to enhance expression efficiency

  • Selection of appropriate fusion tags that minimize interference with protein function

  • Optimization of induction conditions (temperature, inducer concentration, induction time)

  • Implementation of effective lysis and purification protocols that preserve protein structure and function

What functional assays can verify magnesium transport activity of recombinant MRS2-H?

Several complementary approaches can be employed to assess the magnesium transport activity of recombinant MRS2-H:

  • Yeast complementation assays: All members of the Arabidopsis MRS2/MGT family have been shown to complement the growth defect of yeast mrs2 mutants on non-fermentable media with glycerol as the main carbon source (YPdG) . This approach provides a straightforward functional assessment by testing whether MRS2-H can restore growth in yeast strains lacking their endogenous magnesium transporters.

  • Direct magnesium uptake measurements: The mag-fura-2 fluorescent indicator system can be used to directly measure Mg²⁺ uptake into yeast mitochondria or other compartments expressing MRS2-H . This approach allows for real-time quantification of transport activity.

  • Electrophysiological techniques: Patch-clamp or other electrophysiological methods can be used to measure ion currents across membranes containing MRS2-H.

  • Radioactive tracer studies: ²⁸Mg²⁺ can be used to track magnesium movement in systems expressing MRS2-H.

  • Ion competition assays: Testing transport activity in the presence of other divalent cations can reveal selectivity properties of MRS2-H, as studies with human MRS2 have shown distinct effects of different divalent cations (Mg²⁺, Ca²⁺, Co²⁺) on protein oligomerization and function .

How can gene expression analysis of MRS2-H be optimized in different rice tissues?

Optimizing gene expression analysis of MRS2-H across different rice tissues requires careful consideration of methodology at each experimental stage:

  • Sample collection and RNA extraction:

    • Rapidly harvest and freeze tissues in liquid nitrogen to prevent RNA degradation

    • Use a high-quality RNA extraction method, such as the Maxwell RSC Plant RNA Kit used in rice transcriptomic studies

    • Include multiple biological replicates (minimum three) with pooled samples from multiple plants

  • RT-qPCR analysis:

    • Design gene-specific primers using tools like Primer-BLAST

    • Normalize expression to stable reference genes such as OsUbi1, which has been validated in rice expression studies

    • Follow this protocol: 10 min at 95°C, followed by 45 cycles of 95°C for 10 s and 60°C for 30 s, with a dissociation curve analysis to ensure specific amplification

    • Use three biological replicates (each from a pool of four different plants) and three technical replicates per biological sample

  • RNA-Seq analysis:

    • Apply HTSFilter to remove low-expressed genes

    • Use the edgeR package for statistical analysis of read counts

    • Consider genes differentially expressed when meeting criteria of log₂ fold change >0.5 or <−0.5, P ≤ 0.05, and expression level with fragments per kilobase per million mapped reads (FPKMs) ≥ 25

Table 1: Recommended normalization reference genes for MRS2-H expression studies in rice

Reference GeneStability CharacteristicsRecommended Tissue Types
OsUbi1High stability across tissues and treatmentsAll tissues, particularly under stress conditions
OsActinGood for vegetative tissuesLeaf, stem, root
OsEF-1αSuitable for reproductive tissuesPanicle, flower, seed
OsGAPDHBetter for metabolic studiesAll tissues under normal conditions

What strategies can be employed to generate and characterize MRS2-H knockout lines in rice?

Creating and characterizing MRS2-H knockout lines in rice requires a systematic approach combining molecular biology techniques with detailed phenotypic analysis:

  • Generation of knockout lines:

    • T-DNA insertion: Screen T-DNA insertion libraries for insertions in the MRS2-H gene

    • CRISPR/Cas9-mediated gene editing: Design sgRNAs targeting conserved regions of MRS2-H

    • Validate homozygous knockout status by PCR genotyping and sequencing

    • Confirm absence of MRS2-H expression using RT-qPCR and Western blot analysis

  • Phenotypic characterization:

    • Growth assessment under varying magnesium concentrations: Based on studies of Arabidopsis mrs2-7 mutants, a strong magnesium-dependent phenotype of growth retardation was observed when Mg²⁺ concentrations were lowered to 50 μM in hydroponic cultures . Similar experiments should be conducted with rice MRS2-H knockouts.

    • Measure magnesium content in different tissues using ICP-MS or other analytical methods

    • Evaluate response to various stresses, particularly salt stress, given the development of salt-tolerant rice introgression lines mentioned in the literature

    • Assess metabolic parameters that might be affected by altered magnesium homeostasis

  • Molecular characterization:

    • Perform RNA-Seq to identify genes with altered expression in knockout lines

    • Use Gene Ontology (GO) enrichment analysis to identify affected biological processes

    • Investigate changes in expression of other magnesium transporters that might compensate for MRS2-H loss

Studies with Arabidopsis MRS2 family members have shown that single-gene knockouts of some members (MRS2-1, MRS2-5, and MRS2-10) did not show significant phenotypes, nor did double knockout lines (mrs2-1 mrs2-5 and mrs2-5 mrs2-10), suggesting functional redundancy . Therefore, researchers should consider creating multiple gene knockouts when studying MRS2-H in rice.

How can introgression lines be used to study MRS2-H function in different rice backgrounds?

Introgression lines provide a powerful tool for studying gene function in different genetic backgrounds. Drawing from rice salinity tolerance research involving introgression lines:

  • Development of introgression lines:

    • Marker-assisted backcross (MABC) breeding can be employed to transfer genomic regions containing MRS2-H between different rice varieties

    • Use molecular markers such as SSR markers and single nucleotide polymorphism (SNP) markers for foreground and background selection

    • Advanced backcrossing (three cycles) followed by selfing (three cycles) can be used to generate stable introgression lines

  • Marker-assisted approaches for selection:

    • Use KASPar (Kompetitive allele specific PCR) coupled to the Light Cycler 480 system for SNP genotyping

    • Develop SNP markers distributed across all chromosomes for background recovery analysis

    • Track recurrent parent genome (RPG) recovery, which should ideally be >90%

  • Characterization of MRS2-H function across backgrounds:

    • Compare MRS2-H expression levels and patterns in different genetic backgrounds

    • Assess phenotypic differences related to magnesium uptake and utilization

    • Evaluate the impact of different MRS2-H alleles on plant performance under normal and stress conditions

  • Fine mapping using RNA-Seq data:

    • Utilize RNA-Seq datasets to identify SNPs that can be used for fine mapping of introgressed regions containing MRS2-H

    • This approach has been successfully used to map indica regions introgressed into japonica backgrounds

What methodological approaches are most effective for studying MRS2-H regulation under stress conditions?

To elucidate MRS2-H regulation under stress conditions, particularly salt stress, researchers should consider these methodological approaches:

  • Controlled stress application protocols:

    • For salt stress: Use hydroponic cultures with precisely controlled NaCl concentrations (e.g., 80 mM NaCl) and defined exposure times (e.g., 24 hours)

    • Include proper controls and multiple biological replicates (three replicates per genotype and condition, with four plants per replicate)

    • Monitor physiological parameters throughout stress application to ensure consistent stress effects

  • Transcriptomic analysis:

    • Extract total RNA immediately after stress treatment using optimized protocols

    • Perform RNA-Seq or targeted RT-qPCR analysis to measure changes in MRS2-H expression

    • Use statistical tools like edgeR for differential expression analysis

    • Identify transcription factors that might regulate MRS2-H expression under stress

  • Promoter analysis:

    • Clone the MRS2-H promoter region and perform deletion analysis to identify stress-responsive elements

    • Use yeast one-hybrid or chromatin immunoprecipitation (ChIP) to identify transcription factors that bind to the MRS2-H promoter

    • Generate transgenic plants with promoter-reporter constructs to visualize spatial and temporal regulation of MRS2-H expression under stress

  • Post-translational regulation:

    • Investigate protein modifications that might affect MRS2-H function under stress

    • Based on studies of human MRS2, examine whether divalent cations affect MRS2-H oligomerization states, as different divalent cations (Mg²⁺, Ca²⁺, Co²⁺) have been shown to influence the oligomerization of human MRS2 domains

How do structural features of MRS2-H relate to its ion selectivity and transport mechanism?

Understanding the structure-function relationship of MRS2-H requires examining key structural features that determine ion selectivity and transport mechanism:

  • GMN motif and ion selectivity:

    • The GMN (Gly-Met-Asn) tripeptide motif at the end of the first transmembrane domain is critical for Mg²⁺ selectivity in MRS2 family proteins

    • Mutations in this motif can either abolish transport activity entirely or alter ion selectivity

    • Molecular dynamics simulations with human MRS2 have revealed how this conserved motif contributes to selective Mg²⁺ permeation

  • Pore-forming structures:

    • Based on cryo-EM structures of human MRS2, which forms symmetrical pentamers, MRS2-H likely adopts a similar quaternary structure with a central pore for ion conduction

    • Key residues in human MRS2 that function as gating residues include R332 and M336, which have been tested using mutagenesis and cellular divalent ion uptake assays

    • The pentameric assembly creates a charge repulsion barrier (R-ring) that regulates ion permeation

  • N-terminal domain function:

    • The N-terminal domain of human MRS2 functions as a regulatory domain sensitive to divalent cations

    • Different divalent cations (Mg²⁺, Ca²⁺, Co²⁺) affect the oligomerization state of the N-terminal domain, suggesting a regulatory mechanism

    • Studies using dynamic light scattering have shown that addition of 5 mM MgCl₂ or CaCl₂ eliminates larger size distributions of the N-terminal domain, indicating disassembly

  • Driving force for transport:

    • Membrane potential likely serves as the driving force for Mg²⁺ permeation through MRS2-H, similar to human MRS2

    • Understanding how this electrical gradient affects transport activity is essential for characterizing MRS2-H function

What is the role of MRS2-H in maintaining magnesium homeostasis during plant development and stress responses?

MRS2-H likely plays crucial roles in magnesium homeostasis throughout plant development and during stress responses, though specific information about MRS2-H in rice is limited. Based on studies of related transporters:

  • Developmental regulation:

    • Different MRS2/MGT family members in Arabidopsis show distinct tissue-specific expression patterns during development

    • Some members (MRS2-1, MRS2-5) become localized to vascular tissues in expanded cotyledons

    • Others show highly specific expression patterns, such as MRS2-10 in hydathodes and the epicotyl, or MRS2-7 exclusively in roots

    • These diverse expression patterns suggest specialized developmental roles for different family members

  • Salt stress responses:

    • Introgression lines with enhanced salt tolerance have been developed in rice through marker-assisted breeding

    • While the specific contribution of MRS2-H to salt tolerance is not directly addressed in the literature, magnesium transporters likely play important roles in maintaining ion homeostasis under salt stress

    • Analysis of salt-treated rice samples using RNA-Seq has identified differentially expressed genes involved in stress responses

  • Magnesium deficiency responses:

    • In Arabidopsis, mrs2-7 knockout mutants show growth retardation specifically under low magnesium conditions (50 μM)

    • MRS2-H in rice may play a similar role in adapting to magnesium-limited conditions

    • Understanding how plants sense and respond to magnesium deficiency through transporters like MRS2-H is crucial for improving crop performance in marginal soils

  • Metabolic integration:

    • In mitochondria, magnesium ions regulate various metabolic pathways

    • Studies in human cells show that knockdown of MRS2 leads to reduced Mg²⁺ uptake into mitochondria and disruption of mitochondrial metabolism

    • Similar metabolic integration likely occurs in plant systems, where MRS2-H may influence energy metabolism and other magnesium-dependent processes

How can researchers resolve inconsistencies in MRS2-H functional data between different experimental systems?

Researchers often encounter seemingly contradictory results when studying MRS2-H across different experimental systems. Addressing these inconsistencies requires:

  • Systematic comparison of experimental conditions:

    • Document all experimental variables (pH, temperature, ionic strength, expression levels, etc.)

    • Test whether these variables account for observed differences

    • Standardize conditions where possible to facilitate direct comparisons

  • Consider cellular context differences:

    • Heterologous expression systems may lack regulatory components present in native contexts

    • Protein-protein interactions may differ between systems

    • Post-translational modifications may vary, affecting protein function

    • Membrane composition can influence transporter activity

  • Statistical approaches to reconcile data:

    • Meta-analysis techniques can integrate results from multiple studies

    • Bayesian methods can incorporate prior knowledge to resolve apparent contradictions

    • Sensitivity analysis can identify which experimental parameters most strongly influence outcomes

  • Complementary experimental approaches:

    • When faced with contradictory results, employ multiple independent methods to test the same hypothesis

    • For example, combine yeast complementation assays, direct transport measurements, and in planta phenotypic analysis

What statistical frameworks are most appropriate for analyzing MRS2-H expression data under variable conditions?

Selecting appropriate statistical frameworks for analyzing MRS2-H expression data requires consideration of experimental design and data characteristics:

  • For RT-qPCR data:

    • Use relative quantification methods (2^(-ΔΔCt)) with appropriate reference genes like OsUbi1

    • Apply ANOVA or t-tests for simple comparisons between conditions

    • For complex designs with multiple factors, use factorial ANOVA or mixed models

    • When assumptions of normality are violated, consider non-parametric alternatives

  • For RNA-Seq data:

    • Apply HTSFilter to remove low-expressed genes

    • Use specialized packages like edgeR for differential expression analysis

    • Apply appropriate thresholds: log₂ fold change >0.5 or <−0.5, P ≤ 0.05, and FPKMs ≥ 25

    • Control for multiple testing using methods like Benjamini-Hochberg adjustment

  • For time-series data:

    • Consider time-course-specific methods like EDGE or maSigPro

    • Use repeated measures ANOVA or linear mixed models to account for temporal correlation

    • Functional data analysis can model expression as continuous functions over time

  • For multi-omics integration:

    • Correlation-based methods can identify relationships between transcriptomics, proteomics, and metabolomics data

    • Network analysis approaches can uncover regulatory relationships

    • Multivariate statistical methods like principal component analysis or partial least squares can reveal patterns across data types

How can researchers distinguish between direct and indirect effects of MRS2-H manipulation in transgenic studies?

Differentiating direct effects of MRS2-H manipulation from indirect consequences requires careful experimental design and analysis:

  • Temporal analysis:

    • Track changes immediately following MRS2-H perturbation

    • Direct effects typically occur more rapidly than indirect effects

    • Time-course experiments can reveal the sequence of events following MRS2-H manipulation

  • Dose-response relationships:

    • Use inducible expression systems to create varying levels of MRS2-H expression

    • Direct effects usually show clearer dose-response relationships

    • Quantify both MRS2-H levels and phenotypic outcomes

  • Genetic approaches:

    • Create second-site suppressors or enhancers to identify genetic interactions

    • Epistasis analysis can reveal pathway relationships

    • Use double mutants to test hypotheses about interaction with other transporters

  • Biochemical verification:

    • Test for physical interactions between MRS2-H and putative target molecules

    • Use in vitro systems to verify direct effects on magnesium transport

    • Complementation studies with specific MRS2-H domains can identify which portions of the protein mediate different effects

What are the most promising approaches for engineering MRS2-H to improve rice stress tolerance?

Engineering MRS2-H to enhance rice stress tolerance represents an intriguing avenue for crop improvement, with several promising approaches:

How can advanced imaging techniques contribute to understanding MRS2-H localization and dynamics?

Advanced imaging techniques offer powerful tools for studying MRS2-H localization and dynamics in plant cells:

  • Fluorescent protein fusions:

    • Generate MRS2-H-GFP fusions to visualize subcellular localization

    • Use split-GFP or BiFC to investigate protein-protein interactions

    • FRET-based approaches can reveal dynamic interactions with other proteins

  • Super-resolution microscopy:

    • Techniques like STED, PALM, or STORM can resolve structures beyond the diffraction limit

    • Track individual MRS2-H molecules or clusters at nanometer resolution

    • Investigate colocalization with other transporters at unprecedented detail

  • Live-cell imaging with magnesium indicators:

    • Combine MRS2-H-fluorescent protein fusions with magnesium-specific fluorescent indicators

    • Visualize real-time changes in magnesium distribution in response to MRS2-H activity

    • Correlate localization with function using simultaneous imaging approaches

  • Multi-modal imaging:

    • Combine fluorescence imaging with techniques like FRAP to assess protein mobility

    • Use correlative light and electron microscopy to link functional observations with ultrastructural context

    • Implement microfluidic systems for controlled environmental manipulation during imaging

What emerging technologies will advance our understanding of MRS2-H structure-function relationships?

Several emerging technologies hold promise for deepening our understanding of MRS2-H structure-function relationships:

  • Cryo-electron microscopy:

    • Recent advances have enabled high-resolution structures of human MRS2 (2.8 Å and 3.3 Å)

    • Similar approaches could reveal the structure of rice MRS2-H in different conformational states

    • Single-particle analysis can capture structural heterogeneity reflecting different functional states

  • Molecular dynamics simulations:

    • Atomistic simulations can model Mg²⁺ permeation through MRS2-H

    • Investigate how mutations affect ion selectivity and gating

    • Studies with human MRS2 have already employed this approach to understand how Cl⁻ may function as a ferry to jointly gate Mg²⁺ permeation with the R-ring charge repulsion barrier

  • AlphaFold and related AI tools:

    • Predict MRS2-H structure with high accuracy even before experimental structures are available

    • Model interactions with other proteins and membrane components

    • Generate hypotheses about structure-function relationships for experimental testing

  • Genome editing with high-throughput phenotyping:

    • Use CRISPR-based techniques for precise engineering of MRS2-H

    • Create libraries of variants with systematic mutations

    • Couple with high-throughput phenotyping to rapidly assess functional consequences

  • Integrative structural biology:

    • Combine data from multiple structural techniques (X-ray crystallography, cryo-EM, NMR, mass spectrometry)

    • Build comprehensive models of MRS2-H function in its native context

    • Understand dynamic processes that cannot be captured by any single technique

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.