Recombinant Oryza sativa subsp. japonica Putative potassium channel KAT5 (Os04g0117500, LOC_Os04g02720)

Shipped with Ice Packs
In Stock

Description

Role in Potassium Transport

KAT5 is part of the AKT/KAT family of inward-rectifying potassium channels, which are critical for maintaining potassium homeostasis in plant cells . These channels conduct K⁺ ions down their electrochemical gradient, influencing cellular processes such as turgor pressure, nutrient uptake, and stress responses .

Comparative Analysis with Related Channels

A comparison of rice potassium channels highlights functional diversity within the KAT/AKT subfamilies:

ChannelGene IDFunctionStress ResponseSources
KAT5Os04g0117500Putative inward K⁺ transportPotential salinity response
AKT1OsAKT1Root K⁺ uptake, Na⁺ exclusion under stressDownregulated in tolerant varieties
KAT1OsKAT1Root K⁺ transport, salt stress toleranceRepressed in tolerant rice lines

Experimental Utility

The recombinant KAT5 protein serves as a tool for:

  1. Structural studies: Investigating the tetramer formation and selectivity filter (TVGYG motif) critical for K⁺/Na⁺ discrimination .

  2. Functional assays: Electrophysiological studies to measure ion conductance properties.

  3. Protein interaction mapping: Identifying regulatory partners or post-translational modifiers .

Research Gaps and Future Directions

  • Mechanistic studies: Clarifying KAT5’s role in salt stress adaptation, particularly its interaction with other transporters.

  • Phylogenetic analysis: Resolving its classification within the KAT/AKT subfamilies.

  • Transgenic approaches: Overexpression or knockout experiments to assess phenotypic effects in rice.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly include them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Os04g0117500; LOC_Os04g02720; OsJ_13587; OSJNBb0050O03.14; Putative potassium channel KAT5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0117500
Target Protein Sequence
MAARSELLRSAFGKASPSLGWFIVNPHRYSYRWWHMFLIMLVLYSAWASPFELSMEKAAS IALVVIRPSGRCLLRHRHCHILLRHLVTGKRQGLWGLLNLLRLWRLRCASKLFARVEKDV RFSYLWTRLIKLLCVTLFALHFAACIYLWMVFNYKIKELTWIGSQIHSFEDRSVWFCYTC AVYWSITTLATVGYGDLHATNIGEMLFSIAFMLFNMGLTSYIIGNITNLVVRETSNTFKM RDMVQWVSEFGSMNRLPEVMREQMLANGQLRFRTKEQLQHEHVKRIGPRGMVGEIGVMFS IPQPFTIRSRRLTQVVRISHIHLLQAVRPNTADGCIVFSNFILVSDFVEYLESLKVQTKE VAFVSGHL
Uniprot No.

Target Background

Function
This protein is a putative inward-rectifying potassium channel.
Database Links
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the recombinant form of KAT5 differ from the native protein?

The recombinant form of KAT5 differs from the native protein in several key aspects:

  • Tag addition: The recombinant protein contains an N-terminal His-tag, which facilitates purification but may influence protein folding or activity in some experimental contexts .

  • Expression system: The recombinant protein is expressed in E. coli rather than plant cells, which eliminates plant-specific post-translational modifications that might be present in the native form .

  • Purification state: The commercially available recombinant protein is provided as a lyophilized powder with >90% purity as determined by SDS-PAGE, allowing for controlled experimental conditions .

  • Buffer composition: The recombinant protein is reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which may differ from the native cellular environment .

When designing experiments, researchers should consider these differences and potentially validate findings using native protein when possible.

What genomic information is available for Oryza sativa KAT5?

The Oryza sativa KAT5 potassium channel is encoded by the gene Os04g0117500, also designated as LOC_Os04g02720. Several genomic resources provide information about this gene:

  • Chromosome location: The gene is located on chromosome 4 of the rice genome, as indicated by the "Os04" designation in its identifier .

  • Alternative nomenclature: The gene has several synonyms including OsJ_13587 and OSJNBb0050O03.14, which may appear in different databases .

  • UniProt identification: The protein is cataloged in UniProt under the accession number Q7XT08 .

  • Genomic context: Within the rice genome, KAT5 is part of the potassium channel family, which includes multiple members with diverse functions in ion transport and cellular signaling .

This genomic information facilitates comparative analyses with other potassium channels and aids in designing gene-specific primers for experimental manipulation.

What are the optimal conditions for reconstitution and storage of recombinant KAT5 protein?

For optimal reconstitution and storage of recombinant KAT5 protein, the following methodology is recommended:

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freeze-thaw damage

  • Storage conditions:

    • For long-term storage: Store aliquots at -20°C/-80°C in the presence of glycerol

    • For working stocks: Store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Stability considerations:

    • The protein is most stable in the lyophilized form prior to reconstitution

    • Once reconstituted, the protein should be used promptly or properly aliquoted and stored

    • Buffer conditions (Tris/PBS with 6% trehalose, pH 8.0) are optimized for stability

These conditions maximize protein integrity while minimizing degradation, aggregation, or loss of functional activity.

What are the recommended methods for functional characterization of KAT5 potassium channel activity?

For functional characterization of the KAT5 potassium channel, several complementary approaches are recommended:

  • Electrophysiological methods:

    • Patch-clamp recordings in heterologous expression systems (e.g., Xenopus oocytes or HEK293 cells)

    • Two-electrode voltage clamp for measuring whole-cell currents

    • Single-channel recordings to determine conductance properties

    These methods allow for direct measurement of channel kinetics, ion selectivity, and voltage dependence.

  • Ion flux assays:

    • Potassium-selective fluorescent indicators

    • Rubidium flux assays as a potassium surrogate

    • Membrane potential dyes to measure changes in cell polarization

  • Pharmacological characterization:

    • Testing sensitivity to known potassium channel blockers (TEA, 4-AP, barium)

    • Determining pH sensitivity

    • Evaluating response to plant-specific signaling molecules

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues in the pore region and voltage sensor

    • Chimeric constructs with other potassium channels to identify functional domains

When designing these experiments, it's important to consider the transmembrane topology of KAT5 and ensure proper membrane insertion in the expression system. The amino acid sequence suggests typical voltage-gated potassium channel features including a pore domain containing the signature GYG motif critical for potassium selectivity .

How can researchers effectively express KAT5 in heterologous systems for structural studies?

For effective expression of KAT5 in heterologous systems for structural studies, researchers should consider the following methodological approach:

  • Expression system selection:

    • E. coli: While commercially available recombinant KAT5 is produced in E. coli , membrane proteins often face folding challenges in prokaryotic systems

    • Yeast (P. pastoris or S. cerevisiae): Better for eukaryotic membrane proteins with proper folding requirements

    • Insect cells (Sf9, Sf21): Provide eukaryotic processing with higher yield

    • Mammalian cells (HEK293, CHO): Offer native-like lipid environment and post-translational modifications

  • Construct optimization:

    • Include affinity tags (His, FLAG, or Strep) that are removable via protease cleavage sites

    • Consider fusion partners (SUMO, MBP, or GFP) to improve folding and monitor expression

    • Codon optimization for the chosen expression system

    • Modification of hydrophobic regions that might cause aggregation

  • Solubilization and purification strategy:

    • Screen multiple detergents (DDM, LMNG, digitonin) for optimal extraction

    • Consider lipid nanodiscs or amphipols for maintaining native-like environment

    • Implement size exclusion chromatography as a final purification step to ensure homogeneity

  • Structural determination approaches:

    • X-ray crystallography: Requires highly pure, homogeneous, and stable protein preparations

    • Cryo-EM: Increasingly popular for membrane proteins, requires less protein and can capture different conformational states

    • NMR: Best for dynamic regions, typically requires isotope labeling

For KAT5 specifically, the presence of multiple transmembrane segments requires careful consideration of detergent selection to maintain the native structure. Starting with the known sequence and predicted topology can inform rational construct design for structural studies .

What is the physiological role of KAT5 potassium channels in rice stress responses?

The physiological role of KAT5 potassium channels in rice stress responses appears to be multifaceted, particularly in relation to chilling stress:

  • Potassium homeostasis during stress conditions:

    • Potassium channels, including KAT5, are likely involved in maintaining K+ homeostasis during temperature stress

    • The potassium transport activity may contribute to cellular osmotic adjustment during stress conditions

    • Ion channel activity potentially influences membrane potential stabilization under chilling conditions

  • Connection to chilling tolerance:

    • Oryza sativa has two major varietal groups (JAPONICA and INDICA) with different levels of chilling tolerance

    • The JAPONICA subspecies, which contains this particular KAT5 variant, typically exhibits greater chilling tolerance than INDICA varieties

    • Genome-wide association studies have identified multiple quantitative trait loci (QTLs) related to chilling tolerance in rice, potentially including regions containing ion channel genes

  • Signal transduction role:

    • Potassium channels can function within stress signaling pathways

    • KAT5 may interact with components of the two-component signaling (TCS) systems in rice, which are known to mediate responses to environmental stimuli

    • The characteristic structure of KAT5 suggests it could participate in cellular signaling through membrane potential changes

Research examining the expression patterns of KAT5 under various stress conditions, particularly low temperature, would provide valuable insights into its specific physiological roles. Transgenic approaches manipulating KAT5 expression levels could further elucidate its contribution to stress tolerance mechanisms.

How does KAT5 expression vary across different rice tissues and developmental stages?

While the search results don't provide direct information about the tissue-specific expression patterns of KAT5 in rice, a methodological approach to answering this question would include:

  • Expression analysis techniques:

    • Transcriptomic data: RNA-Seq data from different tissues and developmental stages would reveal transcript abundance patterns

    • qRT-PCR: For targeted quantification of KAT5 expression in specific tissues or conditions

    • Promoter-reporter constructs: Creating KAT5 promoter:GUS or KAT5 promoter:GFP fusions to visualize expression patterns in planta

  • Typical expression patterns of rice potassium channels:

    • Potassium channels often show tissue-specific expression related to their physiological functions

    • Root expression may indicate roles in nutrient acquisition

    • Expression in guard cells would suggest functions in stomatal regulation

    • Vascular tissue expression could indicate roles in long-distance potassium transport

  • Developmental regulation:

    • Expression patterns likely change throughout development stages

    • Heightened expression might occur during specific developmental transitions requiring ion flux regulation

    • Seed development and germination often involve significant changes in potassium channel activity

  • Available database resources:

    • Rice Expression Database (RED)

    • Rice Genome Annotation Project

    • Rice Expression Profile Database

    • Massively Parallel Signature Sequencing (MPSS) data

The search results indicate that for other rice genes, MPSS data has been utilized to comment on expression profiles , suggesting similar approaches could be employed for KAT5. Integration of these expression data with functional studies would provide insights into the developmental and physiological significance of KAT5 in different rice tissues.

How does KAT5 interact with other components of ion transport systems in rice?

The interaction of KAT5 with other components of rice ion transport systems requires examination from several perspectives:

Given that TCS pathways in rice are known to participate in important physiological phenomena such as ethylene and cytokinin signaling , it would be valuable to investigate whether KAT5 potassium channel activity is modulated by these or other signaling pathways that help the plant respond to environmental conditions.

How does Oryza sativa KAT5 compare structurally and functionally to other plant potassium channels?

A comparative analysis of Oryza sativa KAT5 with other plant potassium channels reveals several important structural and functional relationships:

  • Structural comparison:

    • The 368-amino acid sequence of Oryza sativa KAT5 contains the characteristic pore region with the GYG motif found in most potassium-selective channels

    • KAT5 shows the typical transmembrane topology of voltage-gated potassium channels, with multiple transmembrane segments

    • The protein contains voltage-sensing domains (VSDs) that are structurally conserved among voltage-gated ion channels

  • Functional classification within the plant potassium channel family:

    • Plant potassium channels typically fall into several major groups:

      • Shaker-type K⁺ channels (inward and outward rectifiers)

      • TPK (tandem-pore K⁺) channels

      • Kir-like channels

    • Based on sequence analysis, KAT5 likely belongs to the Shaker family, which includes both inward and outward rectifying channels

    • The precise functional classification requires electrophysiological characterization

  • Comparative sequence analysis with key residues:

    Channel TypeSelectivity FilterVoltage SensorActivation Kinetics
    Oryza sativa KAT5GYGD PresentUnknown (requires characterization)
    Typical Shaker InwardGYG(D/E)PresentSlow activation
    Typical Shaker OutwardGYG(D/E)PresentRapid activation
    TPK channelsGXG in duplicateAbsentVoltage-independent
  • Evolutionary context:

    • Potassium channels are evolutionarily ancient and highly conserved across plants

    • Rice genome analysis has identified multiple potassium channel families with diverse functions

    • Genome-wide analyses similar to those conducted for two-component signaling systems would provide insight into the evolutionary relationships among rice potassium channels

Further functional characterization through electrophysiological studies would be necessary to fully classify KAT5 within the plant potassium channel family and determine its specific functional properties.

What is the relationship between rice KAT5 and the KAT5/TIP60 acetyltransferase described in mammalian systems?

The shared KAT5 designation between the rice potassium channel and the mammalian acetyltransferase appears to be a case of identical naming for functionally distinct proteins. A detailed examination reveals:

  • Fundamental differences:

    • Mammalian KAT5/TIP60: Functions as a histone lysine acetyltransferase essential for H2AZ lysine 7 acetylation . It's involved in transcriptional activation and cell cycle regulation.

    • Rice KAT5 (Os04g0117500): Characterized as a putative potassium channel with transmembrane domains typical of ion transport proteins .

    • These proteins have entirely different molecular structures, cellular locations, and biochemical functions.

  • Sequence comparison:

    • The mammalian KAT5/TIP60 contains a MYST family acetyltransferase domain and a chromodomain

    • The rice KAT5 contains transmembrane segments and a potassium channel pore region

    • Sequence alignment shows no significant homology beyond what would be expected by chance

  • Cellular localization and function:

    • Mammalian KAT5/TIP60 is predominantly nuclear, functioning in transcription regulation and DNA damage response

    • Rice KAT5 is predicted to be plasma membrane-localized, functioning in ion transport

  • Experimental evidence distinguishing the proteins:

    • Mammalian KAT5/TIP60 has been shown to acetylate cGAS and histones

    • Rice KAT5 has typical potassium channel sequence features suggesting ion transport function

This appears to be a case of coincidental naming rather than homology or shared function. Researchers should be careful not to conflate literature about these distinct proteins despite their shared designation.

How do genetic variations in KAT5 correlate with differing stress tolerance phenotypes across rice varieties?

While the search results don't provide direct information about genetic variations in KAT5 specifically, a methodological framework for investigating this question would include:

  • Approaches for analyzing KAT5 genetic diversity:

    • Whole-genome sequencing data analysis: Examining single nucleotide polymorphisms (SNPs) and insertions/deletions (indels) in KAT5 across diverse rice varieties

    • Targeted sequencing: Focused analysis of the KAT5 locus in stress-tolerant versus sensitive varieties

    • Haplotype analysis: Identifying distinct KAT5 haplotypes and their distribution across rice subpopulations

  • Correlation with stress phenotypes:

    • The Rice Diversity Panel 1 (RDP1), a 354-cultivar subset representing major Oryza sativa subpopulations, provides an excellent resource for genotype-phenotype correlations

    • Chilling tolerance traits in rice are distributed as subpopulation-specific clusters of Tolerant, Intermediate, and Sensitive accessions

    • Genome-wide association studies (GWAS) have identified 245 quantitative trait loci (QTLs) related to chilling tolerance

  • Experimental validation approaches:

    • Transgenic complementation of sensitive varieties with KAT5 alleles from tolerant varieties

    • Electrophysiological characterization of channel variants

    • CRISPR/Cas9-mediated base editing to convert between allelic variants

  • Statistical analysis framework:

    • Multiple regression models to account for population structure

    • Mixed linear models for association mapping

    • Network analysis to identify gene interactions

The different levels of chilling tolerance between JAPONICA and INDICA varieties suggest that genes involved in stress responses, potentially including ion channels like KAT5, may contain genetic variations contributing to these phenotypic differences. A comprehensive analysis of KAT5 sequence variation coupled with functional characterization would illuminate the potential role of this potassium channel in stress adaptation.

What experimental approaches can elucidate the role of KAT5 in rice chilling tolerance mechanisms?

To elucidate the role of KAT5 in rice chilling tolerance mechanisms, researchers should consider the following experimental approaches:

  • Genetic manipulation techniques:

    • Overexpression: Generate transgenic rice lines overexpressing KAT5 under constitutive or stress-inducible promoters

    • Gene silencing: RNAi or CRISPR/Cas9-mediated knockout to assess loss-of-function phenotypes

    • Promoter swapping: Replace the native KAT5 promoter with constitutive or tissue-specific promoters

  • Expression analysis under stress conditions:

    • Transcriptional profiling: RNA-Seq or qRT-PCR to measure KAT5 expression changes during chilling stress

    • Protein abundance: Western blotting or proteomics to assess changes in KAT5 protein levels

    • Subcellular localization: Fluorescent protein fusions to track KAT5 localization during stress

  • Physiological and biochemical measurements:

    • Electrolyte leakage: Measure membrane integrity under chilling stress

    • K+ flux measurements: Use K+-selective microelectrodes to measure ion fluxes in wild-type versus KAT5-modified plants

    • Metabolomic analysis: Identify changes in metabolites involved in cold acclimation

  • Integration with known chilling tolerance mechanisms:

    • Oxidative stress markers: Measure ROS production and antioxidant enzyme activities

    • Membrane lipid composition: Analyze changes in membrane fluidity and lipid saturation

    • Stress signaling components: Assess activation of cold-responsive transcription factors

  • Comparative studies across rice varieties:

    • Allelic variation analysis: Compare KAT5 sequences between chilling-tolerant JAPONICA and sensitive INDICA varieties

    • Quantitative trait loci (QTL) analysis: Determine if KAT5 colocalizes with any of the 245 QTLs identified for chilling tolerance

    • Complementation tests: Express KAT5 from tolerant varieties in sensitive backgrounds

This multi-faceted approach would provide comprehensive insights into how KAT5 functions within the complex network of chilling tolerance mechanisms in rice.

How might post-translational modifications affect KAT5 channel activity in response to environmental signals?

Post-translational modifications (PTMs) likely play crucial roles in regulating KAT5 channel activity in response to environmental signals. A comprehensive research approach to this question would include:

  • Identification of potential PTM sites:

    • In silico prediction: Computational analysis of the KAT5 sequence for potential phosphorylation, ubiquitination, SUMOylation, and glycosylation sites

    • Mass spectrometry: Proteomic analysis of purified KAT5 under different environmental conditions to identify actual PTMs

    • Targeted mutagenesis: Mutation of predicted PTM sites to assess functional significance

  • Regulatory kinases and phosphatases:

    • Kinase prediction: Identification of potential regulatory kinases based on consensus sequence motifs

    • In vitro phosphorylation assays: Recombinant kinase assays with KAT5 protein

    • Phosphatase inhibitor studies: Use of specific inhibitors to assess the role of dephosphorylation in channel regulation

  • Functional consequences of PTMs:

    • Electrophysiology: Patch-clamp analysis of wild-type versus PTM-mimetic mutants (e.g., phosphomimetic S→D or T→E mutations)

    • Trafficking studies: Assessment of how PTMs affect membrane localization and recycling

    • Protein-protein interaction changes: Co-immunoprecipitation or yeast two-hybrid assays to identify PTM-dependent interactions

  • Environmental signal integration:

    • Calcium signaling: Investigation of Ca²⁺-dependent phosphorylation in response to stress

    • Reactive oxygen species (ROS): Analysis of redox-sensitive residues that might undergo oxidative modifications

    • Hormone signaling: Assessment of how plant hormones influence PTM patterns on KAT5

  • Comparison with known regulatory mechanisms:

    • In other systems, KAT5/TIP60 undergoes acetylation that affects its function

    • While the rice KAT5 potassium channel is distinct from the mammalian KAT5/TIP60 acetyltransferase, similar regulatory principles involving PTMs might apply

    • Two-component signaling systems in rice provide a framework for understanding how environmental cues are translated into protein modifications

This methodological framework would provide mechanistic insights into how KAT5 activity is fine-tuned in response to changing environmental conditions, potentially contributing to stress adaptation in rice.

What approaches can be used to develop rice varieties with optimized KAT5 function for improved stress resilience?

Developing rice varieties with optimized KAT5 function for improved stress resilience would require a multi-disciplinary approach combining molecular breeding, genetic engineering, and physiological validation:

  • Genetic resources and molecular breeding approaches:

    • Germplasm screening: Evaluate KAT5 allelic diversity across rice varieties and wild relatives

    • TILLING (Targeting Induced Local Lesions IN Genomes): Screen mutagenized populations for KAT5 variants

    • Marker-assisted selection: Develop molecular markers for beneficial KAT5 alleles

    • Genomic selection: Incorporate KAT5 haplotype information into breeding models

  • Genetic engineering strategies:

    • Promoter engineering: Replace native promoters with stress-inducible or tissue-specific promoters

    • Protein engineering: Modify channel properties through targeted mutations based on structure-function analysis

    • Allele swapping: Replace KAT5 alleles in sensitive varieties with those from tolerant varieties

    • CRISPR/Cas9 base editing: Make precise nucleotide changes to optimize channel function

  • Physiological validation and phenotyping:

    • Controlled environment testing: Evaluate transgenic/edited lines under defined stress conditions

    • Field trials: Assess performance under natural variations in temperature and other stresses

    • Multi-environment testing: Evaluate performance across diverse agroecological zones

  • Integration with systems biology approaches:

    • Transcriptome analysis: Identify genes co-regulated with KAT5 under stress conditions

    • Metabolome profiling: Assess changes in metabolic networks in lines with modified KAT5

    • Interaction network mapping: Identify proteins that interact with KAT5 to identify additional targets

  • Practical implementation considerations:

    • Pyramiding strategy: Combine optimized KAT5 with other stress tolerance genes

    • Background effects: Evaluate the performance of optimized KAT5 in diverse genetic backgrounds

    • Pleiotropic effects: Assess potential trade-offs between stress tolerance and other agronomic traits

This comprehensive approach would facilitate the development of rice varieties with enhanced stress resilience through optimized KAT5 function, contributing to food security in the face of climate change.

What are common challenges in producing functional recombinant KAT5 protein and how can they be addressed?

Producing functional recombinant KAT5 protein presents several challenges typical of membrane proteins. Here are the common issues and methodological solutions:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use specialized expression vectors with strong promoters

      • Consider fusion tags that enhance expression (SUMO, MBP, Trx)

      • Test multiple expression hosts (E. coli, yeast, insect cells)

      • Implement auto-induction media formulations

  • Protein misfolding and aggregation:

    • Challenge: Transmembrane domains may not fold properly, leading to insoluble aggregates

    • Solutions:

      • Lower expression temperature (16-20°C) to slow folding

      • Use specialized E. coli strains (C41/C43, Lemo21) designed for membrane proteins

      • Include chemical chaperones in growth media (glycerol, trehalose)

      • Optimize induction conditions (lower IPTG concentration, longer expression time)

      • Consider cell-free expression systems

  • Difficult solubilization and purification:

    • Challenge: Extracting membrane proteins while maintaining native structure

    • Solutions:

      • Screen multiple detergents systematically (DDM, LMNG, digitonin)

      • Consider newer amphipathic polymers (SMALPs, amphipols)

      • Implement lipid nanodiscs for a more native-like environment

      • Utilize the N-terminal His-tag for initial IMAC purification

      • Apply size exclusion chromatography as a final polishing step

  • Protein instability:

    • Challenge: Purified membrane proteins often destabilize rapidly

    • Solutions:

      • Include stabilizing agents (glycerol, specific lipids)

      • Optimize buffer conditions (pH, ionic strength)

      • Store with 5-50% glycerol as recommended

      • Aliquot to avoid freeze-thaw cycles

      • Consider lyophilization for long-term storage

  • Functional validation challenges:

    • Challenge: Confirming that the recombinant protein retains native function

    • Solutions:

      • Reconstitute into liposomes for functional assays

      • Develop label-free binding assays for ligand interactions

      • Implement electrophysiological techniques (patch-clamp, planar lipid bilayers)

      • Use fluorescent probes to measure ion flux

How can researchers address the challenge of distinguishing KAT5-specific phenotypes from general potassium transport effects?

Distinguishing KAT5-specific phenotypes from general potassium transport effects presents a significant challenge in functional characterization. Here's a methodological framework to address this issue:

  • Genetic specificity approaches:

    • Channel-specific mutations: Introduce mutations that affect KAT5 function but not other K⁺ channels

    • Tissue-specific manipulation: Use promoters with specific expression patterns matching endogenous KAT5

    • Inducible systems: Employ chemical or temperature-inducible promoters to control timing of KAT5 manipulation

    • Complementation tests: Express KAT5 in backgrounds where specific K⁺ channels are knocked out

  • Pharmacological approaches:

    • Selective inhibitors: Identify compounds with preferential effects on KAT5 versus other channels

    • Concentration-dependent effects: Titrate general K⁺ channel blockers to differentially affect channels

    • Competition assays: Use competitive binding to distinguish between channel types

    • Combinatorial pharmacology: Apply multiple inhibitors to isolate channel-specific contributions

  • Electrophysiological discrimination:

    • Biophysical fingerprinting: Characterize unique conductance, kinetics, or voltage-dependence

    • Ion selectivity profiles: Determine K⁺/Na⁺ permeability ratios and other selectivity parameters

    • Single-channel recordings: Identify channel-specific conductance states

    • Specific activation/inactivation parameters: Use voltage protocols that isolate KAT5 activity

  • Protein-protein interaction specificity:

    • Identify unique interacting partners: Perform immunoprecipitation followed by mass spectrometry

    • Design interaction-disrupting peptides: Target KAT5-specific protein-protein interfaces

    • Proximity labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to KAT5

  • Data integration and statistical approaches:

    • Multiple lines of evidence: Combine genetic, pharmacological, and electrophysiological data

    • Principal component analysis: Differentiate KAT5-specific effects from general K⁺ transport

    • Machine learning classification: Train algorithms to recognize KAT5-specific phenotypic signatures

    • Bayesian network modeling: Integrate multiple datasets to infer causal relationships

This comprehensive approach allows researchers to disentangle the specific contributions of KAT5 from the broader effects of potassium transport, providing clearer insights into its unique physiological roles.

What analytical challenges exist in interpreting KAT5 structure-function relationships, and how can they be overcome?

Interpreting structure-function relationships for the KAT5 potassium channel presents several analytical challenges that require strategic methodological approaches:

  • Structural determination limitations:

    • Challenge: Membrane proteins are notoriously difficult to crystallize or prepare for structural studies

    • Solutions:

      • Employ cryo-electron microscopy (cryo-EM) for structure determination without crystallization

      • Use homology modeling based on structurally characterized potassium channels

      • Implement molecular dynamics simulations to predict conformational states

      • Apply NMR for specific domain characterization, particularly flexible regions

      • Consider structural mass spectrometry approaches (HDX-MS, crosslinking-MS)

  • Linking structural elements to specific functions:

    • Challenge: Determining which structural features govern specific channel properties

    • Solutions:

      • Systematic alanine scanning mutagenesis of predicted functional domains

      • Chimeric approaches, swapping domains with functionally characterized channels

      • Correlation of conservation patterns with functional divergence

      • Site-directed mutagenesis guided by structural predictions

      • State-dependent accessibility studies using cysteine modification

  • Temporal resolution of conformational changes:

    • Challenge: Capturing dynamic structural rearrangements during channel gating

    • Solutions:

      • Implement voltage-clamp fluorometry to correlate structural movements with function

      • Use FRET-based sensors to monitor real-time conformational changes

      • Apply single-molecule techniques to observe individual channel dynamics

      • Time-resolved structural methods (TR-FRET, stopped-flow techniques)

      • Computational approaches such as targeted molecular dynamics

  • Integration of structural data with physiological context:

    • Challenge: Translating in vitro structural insights to in vivo function

    • Solutions:

      • Create structure-based mutations for in planta validation

      • Develop in cellulo functional assays that preserve cellular context

      • Correlate structural features with evolutionary conservation and selection

      • Utilize systems biology approaches to place structural insights into signaling networks

      • Apply structural knowledge to design highly specific inhibitors for in vivo validation

  • Data interpretation framework:

    • Challenge: Developing coherent models from diverse and sometimes contradictory data

    • Solutions:

      • Implement Bayesian statistical approaches to weight evidence

      • Develop multiple working hypotheses and design critical experiments

      • Use machine learning to identify patterns in structure-function relationships

      • Create comprehensive databases integrating structural and functional data

      • Establish collaborative networks with complementary expertise

The amino acid sequence of KAT5 (368 aa) provides the foundation for these analyses , with particular attention to the conserved GYG motif and other functionally important regions. By systematically addressing these challenges, researchers can develop a comprehensive understanding of how KAT5's structure dictates its functional properties in rice.

What are the most promising research directions for understanding KAT5's role in rice biology?

The most promising research directions for understanding KAT5's role in rice biology integrate multiple approaches and emerging technologies:

  • Systems biology integration:

    • Placing KAT5 function within broader signaling and metabolic networks

    • Integrating transcriptomic, proteomic, and metabolomic data to create comprehensive models

    • Network analysis to identify key interaction nodes and potential regulatory mechanisms

    • Mathematical modeling of ion transport dynamics at cellular and tissue levels

  • Advanced genetic and genomic approaches:

    • CRISPR-based technologies for precise genome editing and transcriptional modulation

    • Single-cell transcriptomics to understand cell-type specific roles

    • Population genomics to identify natural variation in KAT5 associated with adaptive traits

    • Epigenomic analysis to determine environmental regulation of KAT5 expression

  • Novel imaging and biophysical techniques:

    • Cryo-EM structural determination of KAT5 in different conformational states

    • Advanced fluorescence techniques (FRET, FLIM) to monitor channel activity in vivo

    • Super-resolution microscopy to visualize KAT5 localization and trafficking

    • In situ visualization of ion fluxes using genetically encoded sensors

  • Translational research applications:

    • Development of KAT5 variants with enhanced properties for stress tolerance

    • Creation of synthetic signaling circuits incorporating KAT5 for programmed responses

    • Identification of small molecule modulators for agricultural applications

    • Integration of KAT5 optimization into broader crop improvement strategies

  • Evolutionary and comparative studies:

    • Detailed analysis of KAT5 evolution across diverse plant species

    • Characterization of KAT5 adaptations in extremophile relatives of cultivated rice

    • Comparative functional studies between subspecies with varying stress tolerance

    • Reconstruction of ancestral KAT5 proteins to understand evolutionary trajectories

These research directions leverage the available information on KAT5 structure and potential connections to stress responses , while incorporating emerging technologies for deeper mechanistic understanding.

How might advanced methodologies like AlphaFold or cryo-EM accelerate KAT5 structure-function research?

Advanced structural biology methodologies like AlphaFold and cryo-electron microscopy (cryo-EM) offer transformative potential for KAT5 structure-function research:

  • AlphaFold and computational structure prediction:

    • Immediate structural insights: Generate high-confidence structural models of KAT5 based on its amino acid sequence without the need for experimental structure determination

    • Conformational ensemble prediction: Model multiple functional states to understand gating mechanisms

    • Structure-guided hypothesis generation: Identify key residues for mutagenesis studies

    • Integration with molecular dynamics: Use AlphaFold models as starting points for simulating dynamic behavior

    • Interaction interface prediction: Model KAT5 interactions with regulatory proteins or lipids

  • Cryo-electron microscopy advantages:

    • Native-like conditions: Visualize KAT5 in membrane environments without crystallization

    • Multiple conformational states: Capture diverse functional states in a single experiment

    • Lower protein quantity requirements: Feasible with lower expression yields compared to crystallography

    • Complex assemblies: Determine structures of KAT5 with interacting partners

    • Time-resolved cryo-EM: Potential to capture transient intermediates during channel gating

  • Synergistic integration of computational and experimental approaches:

    • Model validation: Use cryo-EM to validate and refine AlphaFold predictions

    • Targeted functional studies: Design precise experiments based on structural insights

    • Hybrid methodology: Combine low-resolution experimental data with computational refinement

    • Evolutionary insights: Map conservation patterns onto structural models

    • Function prediction: Infer mechanisms based on structural homology with characterized channels

  • Practical research acceleration strategies:

    • Start with AlphaFold models immediately while pursuing experimental structures

    • Use computational predictions to design optimized constructs for cryo-EM

    • Implement in silico mutagenesis to prioritize experimental variants

    • Create structure-based assays for high-throughput functional screening

  • Technical considerations for KAT5:

    • The 368-amino acid sequence is well within the capability of AlphaFold

    • The transmembrane nature of KAT5 presents challenges for cryo-EM that can be addressed with nanodiscs or amphipols

    • The putative tetrameric assembly of functional potassium channels provides internal symmetry that can improve structural determination

These advanced methodologies would significantly accelerate our understanding of how KAT5's structure determines its function in rice potassium transport and stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.