Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2 (Os06g0718300, LOC_Os06g50410)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Os06g0718300; LOC_Os06g50410; OJ1540_H01.15; P0541C02.23; Putative UPF0496 protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os06g0718300
Target Protein Sequence
MIERSNSTPSATPARPPLAVDEEYNQAFRSKSFLDLWSHAHHHLTHTFSSFKLSTSTPCA GRGGAREDDFLHAGGDGGAADDSEQSCSYTVLDDFVLEPSPESLARGARLQQRRRRRPRR HRVETLLIEYFDVTEEACEACSALLAAIGAARRHHLTLRRLLLRLDGGDDDDAKDALARH VRLDNPLSPGSLSEFHDVHARCSPLASRLAAAQRRLRRLARALRIARGTAAAALVGACAA AIVAAVVLAAHALVGIGVAAAAFGATPAGAARWWGRRAAEKVSSRHYARAGATLDAAARG AYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECEEDLRAQL AELEEHVCLCLITINRTRRLVAHEMARGLPPPSPATVTTTSEERLTSS
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the Oryza sativa subsp. japonica UPF0496 protein 2 differ from its indica counterpart?

Comparative sequence analysis reveals several key differences between japonica and indica UPF0496 protein 2:

Positionjaponica (Os06g0718300)indica (OsI_023618)
8-9PAPV
313GA

The most notable difference is at positions 8-9 where the japonica variant has "PA" while the indica variant has "PV" . Another difference is at position 313, where japonica has glycine (G) while indica has alanine (A). These subtle amino acid variations may contribute to functional or structural differences between the proteins in these two rice subspecies, as proteomic studies have shown that protein expression patterns differ significantly between japonica and indica rice varieties .

What are the optimal storage conditions for recombinant UPF0496 protein 2?

For optimal stability and activity retention, the recombinant UPF0496 protein 2 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For working solutions, aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

For long-term storage, reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) and store in aliquots at -20°C/-80°C . A final glycerol concentration of 50% is typically recommended for optimal stability during freeze-thaw cycles.

What expression systems are most effective for producing recombinant Oryza sativa UPF0496 protein 2?

The most effective and well-documented expression system for producing recombinant Oryza sativa UPF0496 protein 2 is Escherichia coli. According to available research data, the full-length protein (amino acids 1-408) fused to an N-terminal His-tag has been successfully expressed in E. coli systems . This bacterial expression system offers several advantages:

  • High yield of recombinant protein

  • Well-established protocols for induction and harvesting

  • Compatibility with N-terminal His-tag for simplified purification

  • Cost-effectiveness compared to eukaryotic expression systems

For optimal expression in E. coli, researchers should consider:

  • Using BL21(DE3) or similar strains designed for protein expression

  • Optimizing induction conditions (IPTG concentration, temperature, duration)

  • Testing different growth media (LB, TB, or auto-induction media)

  • Evaluating protein solubility through small-scale test expressions

While E. coli is the predominant system, researchers investigating protein-protein interactions or post-translational modifications might consider alternative expression systems such as insect cells or yeast, though these would require protocol optimization.

What methodological approaches can optimize purification of His-tagged UPF0496 protein 2?

Purification of His-tagged UPF0496 protein 2 can be optimized through a systematic approach:

  • Lysis buffer optimization:

    • Use Tris-based buffer (pH 8.0) containing 300-500 mM NaCl

    • Include 5-10 mM imidazole to reduce non-specific binding

    • Add protease inhibitors to prevent degradation

    • Consider including 0.1-0.5% non-ionic detergent if membrane association is suspected

  • Affinity chromatography:

    • Use Ni-NTA or TALON resin for His-tag binding

    • Apply sample slowly (0.5-1 ml/min) to maximize binding

    • Wash with increasing imidazole concentrations (10-30 mM)

    • Elute with 250-300 mM imidazole

  • Polishing steps:

    • Consider size exclusion chromatography to separate monomers from aggregates

    • Ion exchange chromatography can remove host cell proteins

    • Dialysis against Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Quality control:

    • Verify purity by SDS-PAGE (should be >90%)

    • Confirm identity by Western blot or mass spectrometry

    • Test activity if functional assays are available

This methodological approach has been shown to yield recombinant protein with greater than 90% purity as determined by SDS-PAGE .

How can I verify the integrity and authenticity of purified recombinant UPF0496 protein 2?

Verification of protein integrity and authenticity requires a multi-faceted approach:

Mass Spectrometry Analysis:

  • MALDI-TOF MS or LC-MS/MS for peptide mass fingerprinting

  • Compare obtained peptide masses with theoretical masses from the sequence

  • Focus on sequence coverage, particularly regions with differences between japonica and indica variants

Proteomic Verification Protocol:

  • Perform in-gel digestion of protein bands from SDS-PAGE with trypsin

  • Extract peptides and analyze by MALDI-TOF MS

  • Search against databases (e.g., NCBInr) using appropriate parameters:

    • Fixed modification: carbamidomethyl

    • Variable modification: Gln->pyro-Glu (N-term Q)

    • Peptide tolerance: ±0.3 Da with MH+ mass values

    • Consider proteins with MOWSE score >64 as credible

Western Blot Analysis:

  • Use anti-His tag antibodies to confirm tag presence

  • If available, use specific antibodies against UPF0496 protein 2

  • Include positive and negative controls for validation

Functional Assays:

  • Since the specific function is not well-characterized, comparative binding studies or structural analyses may be necessary

This comprehensive verification approach ensures both the physical integrity and sequence authenticity of the purified protein.

What proteomic approaches are most suitable for investigating UPF0496 protein function in rice?

For investigating the function of UPF0496 protein 2 in rice, several complementary proteomic approaches are recommended:

Two-Dimensional Electrophoresis (2-DE) and Mass Spectrometry:

  • Extract total protein from rice tissues using appropriate buffer (e.g., containing urea, thiourea, CHAPS)

  • Perform IEF using IPG strips (pH 4-7 linear range is optimal since most rice proteins fall within this range)

  • Separate in second dimension using SDS-PAGE

  • Stain with Coomassie Blue R-250

  • Analyze differentially expressed spots using image analysis software

  • Excise spots of interest for MS identification

This approach has successfully identified differentially expressed proteins between rice subspecies, with more than 678 protein spots detectable in Coomassie blue R-250 stained gels .

Co-Immunoprecipitation (Co-IP) and Pull-Down Assays:

  • Use the recombinant His-tagged UPF0496 protein 2 as bait

  • Pull down potential interacting partners from rice cell extracts

  • Identify interacting proteins by mass spectrometry

  • Validate interactions through reciprocal Co-IP or yeast two-hybrid assays

Subcellular Localization Studies:

  • Create fluorescent protein fusions (e.g., GFP-UPF0496)

  • Express in rice protoplasts or transformed plants

  • Visualize localization using confocal microscopy

  • Correlate localization with potential functions

Comparative Proteomics Between Subspecies:

  • Compare protein expression patterns between japonica and indica rice varieties

  • Identify proteins with similar expression patterns to UPF0496 protein 2

  • Build potential functional networks based on co-expression data

These proteomic approaches provide complementary data that can help elucidate the function of this poorly characterized protein.

How can researchers investigate potential roles of UPF0496 protein 2 in rice development?

To investigate potential roles of UPF0496 protein 2 in rice development, researchers should implement a multi-faceted experimental approach:

Gene Expression Analysis:

  • Design specific primers for quantitative real-time PCR (qRT-PCR) targeting UPF0496 protein 2

  • Extract RNA from different tissues and developmental stages

  • Synthesize cDNA using standard protocols

  • Perform qRT-PCR using appropriate reference genes (e.g., ACTIN)

  • Analyze expression patterns across developmental stages and tissue types

Reverse Genetics Approaches:

  • Generate knockout or knockdown lines using CRISPR/Cas9 or RNAi

  • Characterize phenotypes across developmental stages

  • Perform complementation studies with both japonica and indica variants

  • Create overexpression lines to observe gain-of-function phenotypes

In Vitro Fertilization (IVF) System Analysis:

  • The IVF system established for rice can be used to study early developmental stages

  • Investigate whether UPF0496 protein 2 is present in zygotes or early embryos

  • Assess if the protein is among those released by feeder cells that influence zygotic development

  • Determine if the protein has hydrolytic activity similar to other enzymes involved in early development

Comparative Studies with Other UPF0496 Family Members:

  • Investigate functional redundancy with other family members (e.g., UPF0496 protein 5)

  • Compare expression patterns and phenotypic effects of mutations

  • Determine if there are subspecies-specific differences in expression or function

This comprehensive approach will provide insights into the developmental roles of UPF0496 protein 2 in rice.

What are the most significant differences in UPF0496 protein expression between indica and japonica rice varieties?

The expression patterns of UPF0496 proteins show notable differences between indica and japonica rice varieties, which can be analyzed through various comparative approaches:

Differential Expression Analysis:
Comparative proteomic studies between japonica (Nipponbare) and indica (93-11) rice varieties have identified 47 proteins that differ significantly in expression levels . While UPF0496 protein 2 specifically was not highlighted in these studies, the methodology provides a framework for investigating its differential expression:

  • Extract total protein from both subspecies

  • Perform 2-DE separation

  • Analyze spot intensities quantitatively

  • Validate differences through qRT-PCR

Expression Pattern Comparison:
When studying expression differences, researchers should consider:

  • Tissue-specific expression patterns

  • Developmental stage variations

  • Responses to environmental stresses

  • Post-translational modifications that may differ between subspecies

Sequence Variation Impact Assessment:
The amino acid differences between japonica and indica UPF0496 protein 2 variants (particularly at positions 8-9 with PA vs. PV, and at position 313 with G vs. A) may affect:

  • Protein stability and half-life

  • Subcellular localization

  • Protein-protein interaction capabilities

  • Enzymatic activity if applicable

Methodological Approach for Expression Analysis:

  • Design primers that either target conserved regions (for general expression) or variant-specific regions (for subspecies-specific expression)

  • Use the ACTIN gene as an internal reference for qRT-PCR

  • Perform PCR with appropriate thermal cycling: 2 min at 94°C, followed by 40 cycles of 15 s at 94°C, 15 s at 56-60°C, and 10 s at 72°C

  • Analyze results using appropriate statistical methods (e.g., Student's t-test with p<0.05 for significance)

These comparative analyses can reveal functional differences that may contribute to the distinct characteristics of indica and japonica rice varieties.

How can UPF0496 protein 2 contribute to understanding evolutionary relationships in rice subspecies?

UPF0496 protein 2 offers valuable insights into the evolutionary relationships between rice subspecies through several analytical approaches:

Sequence Divergence Analysis:
The amino acid differences between japonica and indica variants of UPF0496 protein 2 represent evolutionary divergence events that occurred after the separation of these subspecies. By comparing these sequences alongside those from wild rice species and other cereals, researchers can:

  • Construct phylogenetic trees based on sequence alignments

  • Calculate evolutionary rates and selection pressures

  • Identify conserved domains versus variable regions

  • Determine if changes are likely to be functionally significant

Comparative Genomic Context:
The genomic environment of UPF0496 protein 2 genes in different rice subspecies can reveal:

  • Synteny conservation or disruption

  • Presence of transposable elements that may influence expression

  • Regulatory element differences that might affect transcription

  • Evidence of selective pressure through Ka/Ks ratio analysis

Lineage-Specific Adaptation:
Research has shown that both Oryza sativa and Arabidopsis thaliana possess lineage-specific genes that may account for observed differences between species . By examining whether UPF0496 protein 2 shows patterns consistent with:

  • Purifying selection (conservation)

  • Positive selection (adaptive evolution)

  • Neutral evolution (drift)

Researchers can gain insights into whether this protein contributes to subspecies-specific adaptations.

Evolutionary Process Analysis:
Studies suggest that natural selection has played a role in determining the number of duplicate genes in rice, suppressing or favoring duplication depending on gene function . Investigating UPF0496 family members could reveal:

  • Patterns of gene duplication specific to certain lineages

  • Functional divergence after duplication events

  • Correlation between duplication patterns and ecological niches

These evolutionary analyses provide a deeper understanding of the forces shaping rice diversity and adaptation.

What role might UPF0496 protein 2 play in rice stress response mechanisms?

While the specific function of UPF0496 protein 2 in stress response is not fully characterized, several methodological approaches can help elucidate its potential roles:

Expression Analysis Under Stress Conditions:

  • Subject rice plants to various stresses (drought, salinity, cold, heat, pathogens)

  • Extract RNA at different time points after stress application

  • Perform qRT-PCR to quantify UPF0496 protein 2 expression changes

  • Compare expression patterns between japonica and indica varieties to identify subspecies-specific responses

Transgenic Approaches:

  • Generate overexpression and knockout/knockdown lines for UPF0496 protein 2

  • Subject these lines to various stress conditions

  • Assess phenotypic differences in stress tolerance

  • Measure physiological parameters (ROS levels, osmolyte accumulation, photosynthetic efficiency)

Protein Interaction Studies Under Stress:

  • Perform yeast two-hybrid or co-immunoprecipitation under normal and stress conditions

  • Identify stress-specific interaction partners

  • Analyze subcellular localization changes during stress

  • Investigate post-translational modifications induced by stress

Comparative Analysis with Related Proteins:
Interestingly, UPF0496 protein 1 has been identified in studies of conditioned medium affecting zygotic development . This suggests potential roles in cellular communication or secreted signals. Similar functions might be investigated for UPF0496 protein 2, especially in the context of stress response:

UPF0496 Family MemberGene LocusPotential Function Based on Expression/Detection
UPF0496 protein 1Os10g0359200Detected in conditioned medium, possible role in cellular communication
UPF0496 protein 2Os06g0718300Unknown, subject of investigation
UPF0496 protein 5Os10g0359200Unknown, different gene locus but similar family

These methodological approaches provide a framework for investigating the potential stress-response functions of UPF0496 protein 2 in rice.

How can advanced structural biology techniques be applied to characterize UPF0496 protein 2?

Advanced structural biology techniques provide crucial insights into protein function through structure determination. For UPF0496 protein 2, researchers can employ:

X-ray Crystallography Protocol:

  • Purify recombinant protein to >95% homogeneity

  • Screen crystallization conditions systematically:

    • Vary protein concentration (5-20 mg/ml)

    • Test different precipitants (PEG, salts, alcohols)

    • Adjust pH (4.0-9.0) and temperature (4°C, 18°C)

  • Optimize crystallization conditions for diffraction-quality crystals

  • Collect diffraction data at synchrotron radiation facilities

  • Process data and solve structure using molecular replacement or experimental phasing

NMR Spectroscopy Approach:

  • Express isotopically labeled protein (15N, 13C)

  • Purify to homogeneity and prepare in NMR buffer

  • Collect 2D and 3D spectra for backbone and side-chain assignments

  • Analyze NOE data for distance constraints

  • Generate structural models and validate

Cryo-Electron Microscopy:
Particularly useful if UPF0496 protein 2 forms complexes or has a modular structure:

  • Prepare protein samples on grids with vitrification

  • Collect images using high-resolution cryo-EM

  • Process images and perform 3D reconstruction

  • Build atomic models and validate

Computational Structure Prediction:
While experimental approaches are ideal, computational methods can provide initial insights:

  • Use AlphaFold2 or RoseTTAFold for prediction

  • Validate using molecular dynamics simulations

  • Identify potential functional sites and conserved structural features

  • Generate hypotheses for experimental validation

Functional Annotation Through Structure:
The determined structure can provide functional insights through:

  • Identification of potential active sites

  • Recognition of structural homology to proteins of known function

  • Discovery of binding pockets for potential ligands

  • Understanding of differences between japonica and indica variants at the structural level

These structural biology approaches would significantly advance understanding of UPF0496 protein 2 function, especially given its current classification as a "putative" protein with unknown function.

What are the potential applications of UPF0496 protein 2 in rice improvement programs?

Understanding UPF0496 protein 2 could contribute to rice improvement programs through several research pathways:

Marker-Assisted Selection:
If UPF0496 protein 2 variants are associated with desirable traits, researchers could:

  • Develop molecular markers based on sequence polymorphisms between japonica and indica variants

  • Screen germplasm collections for beneficial alleles

  • Incorporate these markers into breeding programs

  • Track introgression of desired alleles into elite cultivars

Genetic Engineering Approaches:
Based on functional characterization results:

  • Introduce optimal UPF0496 protein 2 variants into elite cultivars

  • Modify expression levels if beneficial for specific traits

  • Engineer protein variants with enhanced functions

  • Stack with other beneficial genes for multiple trait improvement

Comparative Genomic Applications:
Studies have shown that rice and Arabidopsis genomes possess lineage-specific genes that might account for observed differences between species . If UPF0496 protein 2 is found to be rice-specific or cereal-specific:

  • Investigate its contribution to cereal-specific traits

  • Determine if it represents a potential target for creating novel cereal characteristics

  • Explore transferability to other crops for trait improvement

Phenotypic Impact Assessment:
Before application in breeding programs, researchers should conduct thorough phenotypic evaluations:

  • Field trials with modified UPF0496 protein 2 expression or sequence

  • Assessment across multiple environments and stresses

  • Yield component analysis

  • Quality parameter evaluation

  • Interaction with genetic background (different varieties)

These applications represent the translational aspect of basic research on UPF0496 protein 2, potentially contributing to food security through improved rice varieties.

What controls should be included when studying recombinant UPF0496 protein 2 expression and function?

Rigorous experimental design for studying UPF0496 protein 2 requires comprehensive controls:

Expression System Controls:

  • Empty Vector Control: Cells transformed with expression vector lacking the UPF0496 gene

  • Known Protein Control: Expression of a well-characterized protein of similar size with the same tag

  • Induction Controls: Time course of induction to optimize expression

  • Host Strain Variations: Testing multiple E. coli strains to optimize expression

Purification Controls:

  • Column Flow-Through: Analysis to confirm binding efficiency

  • Wash Fractions: Monitoring to prevent premature elution

  • Tag-Only Control: Purification of the tag alone to identify tag-specific artifacts

  • Known Protein Standard: For quantification and purity comparison

Functional Assay Controls:

  • Heat-Inactivated Protein: To distinguish enzymatic from non-enzymatic effects

  • Buffer-Only Control: To account for buffer components' effects

  • Related Protein Controls: Other UPF0496 family members to test specificity

  • Subspecies Variants: Both japonica and indica versions to evaluate functional differences

Protein-Protein Interaction Controls:

  • Negative Control Proteins: Unrelated proteins with similar properties

  • Positive Control Interactions: Known interacting protein pairs

  • Tag Competition Assays: To exclude tag-mediated interactions

  • Reciprocal IP Validations: Confirming interactions in both directions

These controls ensure that experimental results are specific, reproducible, and accurately attributed to UPF0496 protein 2 rather than experimental artifacts.

How can researchers address the challenges of working with proteins of unknown function like UPF0496 protein 2?

Working with proteins of unknown function presents unique challenges that can be addressed through systematic approaches:

Function Prediction Strategies:

  • Sequence-Based Analysis:

    • Search for conserved domains using InterPro, Pfam, SMART

    • Identify sequence motifs associated with specific functions

    • Perform remote homology detection using PSI-BLAST or HHpred

  • Structure-Based Approaches:

    • Predict structure using AlphaFold2 or similar tools

    • Compare predicted structure with known structures using DALI or TM-align

    • Identify potential active sites or binding pockets

  • Omics Integration:

    • Analyze co-expression networks to identify functional associations

    • Examine protein-protein interaction data for clues to function

    • Integrate metabolomic data to identify potential substrates

Experimental Function Discovery:

  • Activity Screening:

    • Test for common enzymatic activities (hydrolase, transferase, etc.)

    • Screen against compound libraries for binding partners

    • Evaluate impact on common cellular processes

  • Reverse Genetic Approaches:

    • Generate knockout/knockdown lines

    • Characterize phenotypes across multiple conditions

    • Perform transcriptomic analysis of mutant lines

  • Localization Studies:

    • Determine subcellular localization using fluorescent protein fusions

    • Examine tissue-specific expression patterns

    • Investigate dynamic localization under different conditions

Comparative Analysis Framework:
Study UPF0496 protein 2 in the context of:

  • Other UPF0496 family members

  • Japonica versus indica variants

  • Related proteins in other plant species

By systematically applying these strategies, researchers can gradually build a functional profile of UPF0496 protein 2, moving from "putative" to characterized status.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.