Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 1 (SCAMP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCAMP1; Os07g0564600; LOC_Os07g37740; OJ1112_E08.118; OsJ_023796; Secretory carrier-associated membrane protein 1; Secretory carrier membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SCAMP1
Target Protein Sequence
MAGRYDSNPFEEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSVSSNSRLSPLPPE PAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIEEKNWPP FLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKIWLLAII YFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVFEGKSLA GILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGKAAEMKRDATRG AMRAAF
Uniprot No.

Target Background

Function
Likely involved in membrane trafficking.
Database Links
Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is SCAMP1 in Oryza sativa?

SCAMP1 (Secretory carrier-associated membrane protein 1) in Oryza sativa is a post-Golgi integral membrane protein that plays a crucial role in the endocytic pathway of rice cells. The full-length protein consists of 306 amino acids and is encoded by the SCAMP1 gene (synonyms: Os07g0564600, LOC_Os07g37740, OJ1112_E08.118, OsJ_023796) with UniProt ID Q8H5X5. The protein is homologous to animal SCAMP1 proteins but demonstrates plant-specific localization and functional characteristics . SCAMP1 is part of the membrane trafficking machinery in rice cells, particularly involved in defining specific compartments in the endocytic pathway.

How does rice SCAMP1 compare to other plant SCAMPs?

Rice SCAMP1 shares significant homology with other plant SCAMP proteins while maintaining species-specific characteristics. Research has shown that the rice SCAMP1 functions similarly to its homologs in other plants, particularly in membrane trafficking. When comparing to model plants like Arabidopsis thaliana, rice SCAMP1 demonstrates conserved domains but potentially lineage-specific functions that may account for observed differences between species . Comparative genomic analyses suggest that while functional domains are similar across species, the evolutionary processes have led to species-specific adaptations in SCAMP proteins, potentially reflecting differences in cellular organization between monocots and dicots.

Where is SCAMP1 localized in rice cells?

SCAMP1 in rice demonstrates a distinctive localization pattern. Confocal immunofluorescence and immunogold electron microscopy studies have shown that native SCAMP1 and YFP-SCAMP1 fusion proteins localize primarily to:

  • The plasma membrane

  • Mobile structures in the cytoplasm of cells

  • Tubular-vesicular structures at the trans-Golgi with clathrin coats

Importantly, these SCAMP1-positive organelles are distinct from the Golgi apparatus and prevacuolar compartments (PVCs). They represent early endosomal compartments that resemble the previously described partially coated reticulum and trans-Golgi network in plant cells .

What role does SCAMP1 play in plant endocytic pathways?

SCAMP1 plays a critical role in defining specific compartments in the plant endocytic pathway. Research demonstrates that SCAMP1-labeled organelles likely represent early endosomes because:

  • Internalized endocytic markers (FM4-64 and AM4-64) reach these SCAMP1-positive organelles before they reach prevacuolar compartments

  • Wortmannin treatment causes redistribution of SCAMP1 from early endosomes to PVCs, suggesting fusion between these compartments

  • SCAMP1-positive organelles are identified as tubular-vesicular structures with clathrin coats, consistent with their role in the early endocytic pathway

These findings suggest that SCAMP1 serves as an essential component in mediating endocytosis in plant cells, similar to its role in animal cells but with plant-specific characteristics .

What expression systems are optimal for producing recombinant rice SCAMP1?

For the expression of recombinant rice SCAMP1, E. coli has been demonstrated as an effective heterologous expression system. The recombinant full-length protein (1-306 aa) can be successfully expressed with N-terminal His tags, which facilitate purification while preserving protein function. The expression construct should contain the complete coding sequence for optimal results .

Expression SystemTagProtein LengthAdvantages
E. coliN-terminal HisFull Length (1-306)High yield, simplified purification, cost-effective
Tobacco BY-2 cellsYFP fusion (N or C terminal)Full LengthNative-like processing, suitable for localization studies

When studying localization and function in plant cells, transgenic tobacco BY-2 cells expressing YFP-SCAMP1 or SCAMP1-YFP fusions have proven valuable for visualizing the protein in living cells and conducting drug treatment studies .

What fluorescent protein fusions are effective for studying SCAMP1 in plant cells?

Yellow Fluorescent Protein (YFP) fusions have been successfully used to study SCAMP1 localization and dynamics in plant cells. Both N-terminal (YFP-SCAMP1) and C-terminal (SCAMP1-YFP) fusions have been generated in transgenic tobacco BY-2 cells with successful expression and proper localization. These fluorescent fusions allow for:

  • Real-time visualization of SCAMP1 localization

  • Tracking of organelle dynamics

  • Co-localization studies with other cellular markers

  • Monitoring responses to drug treatments

This approach allows researchers to distinguish SCAMP1-positive compartments from other cellular structures, facilitating the detailed characterization of the early endosomal system in plant cells .

How can immunogold electron microscopy be optimized for SCAMP1 detection?

For high-resolution localization of SCAMP1 in plant cells, immunogold electron microscopy with high-pressure frozen/freeze-substituted samples has proven effective. The protocol involves:

  • Sample preparation: High-pressure freezing of plant material to preserve native structure

  • Freeze substitution: Replacing ice with organic solvents containing fixatives

  • Resin embedding and ultrathin sectioning

  • Immunolabeling with anti-SCAMP1 antibodies followed by gold-conjugated secondary antibodies

  • Visualization by transmission electron microscopy

This technique has successfully identified SCAMP1-positive organelles as tubular-vesicular structures at the trans-Golgi with clathrin coats, providing nanometer-scale resolution of SCAMP1 localization .

What drug treatments can distinguish SCAMP1-positive compartments from other cellular structures?

Pharmacological approaches are valuable for differentiating SCAMP1-positive compartments from other organelles in the endomembrane system. Key treatments include:

  • Wortmannin treatment: Causes redistribution of SCAMP1 from early endosomes to PVCs, likely due to fusion between these compartments

  • Endocytic tracers: FM4-64 and AM4-64 reach SCAMP1-positive organelles before PVCs, confirming their identity as early endosomes

  • Brefeldin A: Can be used to distinguish SCAMP1-positive structures from Golgi apparatus

These drug treatments, combined with live-cell imaging of fluorescently tagged SCAMP1, allow for functional characterization of SCAMP1-positive compartments and their distinction from other elements of the endomembrane system .

What are the optimal conditions for storing and handling recombinant SCAMP1?

For maintaining recombinant SCAMP1 protein stability and activity, the following storage and handling protocols are recommended:

  • Upon receipt, briefly centrifuge vials to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

  • For working stocks, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly decreases protein stability

The protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage and reconstitution .

How does SCAMP1 evolution in rice compare to other species?

Comparative genomic analyses between rice (Oryza sativa) and Arabidopsis thaliana reveal insights into SCAMP1 evolution. The evolutionary process of protein-coding genes, including SCAMP1, suggests:

  • Both rice and Arabidopsis genomes possess lineage-specific genes that may account for observed phenotypic differences

  • Despite divergence, they maintain similar sets of predicted functional domains among protein sequences

  • Natural selection appears to have played a role in the evolution of duplicated genes in both species

  • Gene duplication has been either suppressed or favored depending on gene function

These evolutionary patterns suggest that while the basic function of SCAMP proteins is conserved across plants, species-specific adaptations have occurred, potentially reflecting differences in cellular organization between monocots like rice and dicots like Arabidopsis .

What genomic resources exist for studying rice SCAMP1 in the context of the rice genome?

The complete genome annotation of Oryza sativa L. ssp. japonica cultivar Nipponbare provides robust resources for studying SCAMP1 in its genomic context. Available resources include:

  • Manually curated functional annotations for proteins including SCAMP1

  • Information on insertional mutant lines that can be used for functional validation

  • cDNA sequences from rice and other representative cereals that help determine rice loci

  • Comparative genomic data between rice and Arabidopsis thaliana

These resources facilitate comprehensive analysis of SCAMP1's role in rice cellular functions and its evolutionary relationships to other proteins. The rice genome annotation project identified approximately 32,000 genes, providing context for understanding SCAMP1's position within the rice proteome .

How might SCAMP1 be utilized as a marker for early endosomes in plant research?

SCAMP1 shows significant potential as a marker for early endosomal compartments in plant cells, which could advance our understanding of the plant endocytic pathway. Future research applications include:

  • Using fluorescently tagged SCAMP1 to track early endosome dynamics in living cells

  • Studying protein trafficking through the early endocytic pathway

  • Investigating the effects of environmental stresses on endocytic trafficking

  • Examining differences in endocytic pathways across diverse plant species

The distinct localization pattern of SCAMP1 to tubular-vesicular structures with clathrin coats at the trans-Golgi makes it an ideal marker for these early endosomal compartments, which have been previously described as partially coated reticulum and trans-Golgi network in plant cells .

What are the implications of SCAMP1 function for rice crop improvement?

Understanding SCAMP1's role in membrane trafficking and endocytosis could have significant implications for rice crop improvement. Potential applications include:

  • Enhancing stress responses through modified membrane trafficking

  • Improving nutrient uptake efficiency via optimized endocytic pathways

  • Developing rice varieties with enhanced tolerance to environmental challenges

  • Engineering improved pathogen resistance through modified membrane dynamics

As the majority of the world's population depends on cereal crops like rice for their primary source of carbohydrate, making up approximately 20% of total caloric intake, advances in understanding fundamental cellular processes like those mediated by SCAMP1 could contribute to developing more efficient rice cultivars to meet global food demands .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.