Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 2 (SCAMP2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Oryza sativa subsp. japonica SCAMP2

Recombinant SCAMP2 is a bioengineered version of the endogenous secretory carrier-associated membrane protein 2 from Oryza sativa subsp. japonica (rice). It belongs to the SCAMP family, which facilitates vesicle trafficking in post-Golgi pathways . This recombinant protein is produced via bacterial expression systems (e.g., E. coli) and retains functional domains critical for interactions with target molecules .

Key Specifications (Table 1):

PropertyValueSource
Expression SystemE. coli
TagHis (N-terminal)
Protein LengthFull-length (1–286 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
AA SequenceMAGRYDRNPFDEDDVNPFAGGSVPPASNSRMPPLPHEPGFYNDRGATVDIPLDSTKDMKK...

In Plant Cells

SCAMP2 localizes to the trans-Golgi network (TGN) and secretory vesicle clusters (SVCs), which mediate mass transport to the plasma membrane or cell plate during cytokinesis . Key findings:

  • SVC Dynamics: SCAMP2-marked SVCs fuse with the plasma membrane in non-dividing cells and target the cell plate in dividing cells .

  • Colocalization: SCAMP2 interacts with SYP41 (a TGN marker) in Arabidopsis and tobacco cells, supporting its role in post-Golgi trafficking .

In Mammalian Systems

SCAMP2 regulates membrane protein trafficking with notable effects on ion channels:

  • NKCC2/NCC Transporters: In renal cells, SCAMP2 binds the C-terminal regions of NKCC2 and NCC, reducing their surface expression by impairing exocytosis .

  • T-Type Calcium Channels: Co-expression of SCAMP2 with Ca v3.2 channels in mammalian cells abolishes T-type currents by retaining channels in recycling endosomes .

Comparative Functional Roles (Table 3):

Organism/SystemTarget MoleculeMechanism of ActionOutcomeReference
Oryza sativaSecretory vesiclesMediates SVC formation and fusionPlasma membrane/cell plate targeting
Mammalian (renal)NKCC2/NCC transportersBlocks exocytotic traffickingReduced ion cotransport activity
Mammalian (neuronal)Ca v3.2 channelsRetains channels in recycling endosomesLoss of T-type currents

Trafficking Regulation

  • Exocytosis Inhibition: Overexpression of SCAMP2 reduces the surface abundance of NKCC2 and Ca v3.2 channels by 91–98%, as shown via patch-clamp electrophysiology and biotinylation assays .

  • Endosomal Retention: SCAMP2 colocalizes with recycling endosome markers, suggesting it sequesters target proteins in intracellular compartments .

Recombinant SCAMP2 in Biochemical Assays

  • ELISA Detection: Recombinant SCAMP2 serves as a standard in ELISA kits for quantifying endogenous SCAMP2 levels .

  • Protein Interaction Studies: Used in co-immunoprecipitation (Co-IP) to identify binding partners (e.g., Ca v3.2, NKCC2) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate this need in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SCAMP2; SC; Os01g0780500; LOC_Os01g57220; P0010B10.29; Secretory carrier-associated membrane protein 2; RiSC; Secretory carrier membrane protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SCAMP2
Target Protein Sequence
MAGRYDRNPFDEDDVNPFAGGSVPPASNSRMPPLPHEPGFYNDRGATVDIPLDSTKDMKK KEKELQAKEAELNKRESELRRREEAASRAGIVIEEKNWPPFFPIIHHDISNEIPIHLQRM QYLAFSSLLGLAACLFWNIIATTAAWIKGAGVMIWLLAIIYFISGVPGAYVLWYRPLYNA MRTESALKFGWFFLFYLIHILFCIWSAVAPPFPFKGKSLAGILPAIDVIGNNAIVGIFYF IGFGLFCLESLLSVVVIQQVYMYFRGSGKAAEMKREAARGAMRSAF
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 2 (SCAMP2) is likely involved in membrane trafficking.
Database Links

KEGG: osa:4327836

STRING: 39947.LOC_Os01g57220.1

UniGene: Os.2359

Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of SCAMP2 in Oryza sativa subsp. japonica?

SCAMP2 belongs to the secretory carrier-associated membrane protein family, which functions in membrane trafficking and vesicular transport. Similar to other SCAMPs like SCAMP4 and SCAMP6, SCAMP2 is characterized by multiple transmembrane domains and cytoplasmic N-terminal and C-terminal regions. The protein typically contains conserved leucine-zipper-like motifs and phosphorylation sites that regulate its function. SCAMPs generally participate in post-Golgi trafficking, endocytosis, and exocytosis processes in plant cells, contributing to membrane dynamics during cellular responses to environmental stimuli .

How should recombinant SCAMP2 be expressed and purified for research purposes?

Based on established protocols for other rice SCAMPs, recombinant SCAMP2 is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. The recommended expression system involves:

  • Cloning the full-length SCAMP2 coding sequence into an expression vector with an N-terminal His-tag

  • Transforming the construct into an appropriate E. coli strain (BL21 or similar)

  • Inducing expression with IPTG at optimal temperature and duration

  • Lysing cells and purifying using nickel affinity chromatography

  • Further purification may involve ion exchange chromatography or size exclusion chromatography

The purified protein is typically obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

What are the optimal storage conditions for recombinant SCAMP2 protein?

For optimal stability and activity, recombinant SCAMP2 should be stored following these guidelines:

  • Long-term storage: -20°C to -80°C in aliquots to avoid repeated freeze-thaw cycles

  • Short-term working aliquots: 4°C for up to one week

  • Storage buffer: Tris-based buffer with 50% glycerol (similar to other SCAMP proteins) or Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage

Repeated freezing and thawing should be avoided as it may lead to protein degradation and loss of functional activity .

How does SCAMP2 differ structurally and functionally from other SCAMP family members in rice?

FeatureSCAMP2SCAMP4SCAMP6
Protein Length~280-320 aa (estimated)313 aa273 aa
Chromosomal LocationUnknown from search resultsOs03g0582200Os04g0597000, Os04g0595800
Gene IDUnknown from search resultsLOC_Os03g38590LOC_Os04g50890
UniProt IDUnknown from search resultsQ75IC7Q0JAI9
Conserved DomainsTransmembrane domains, NPF motifsTransmembrane domains, NPF motifsTransmembrane domains, NPF motifs
Subcellular LocalizationPlasma membrane, vesicle membranesPlasma membrane, vesicle membranesPlasma membrane, vesicle membranes

While all SCAMPs share core structural features related to membrane trafficking, they likely have specialized functions and tissue-specific expression patterns. SCAMP2 may have distinct sorting signals or protein interaction domains that determine its specific functional role in rice cellular processes .

What experimental approaches are most effective for investigating SCAMP2 function in rice?

Effective experimental approaches include:

  • Subcellular localization studies:

    • GFP fusion constructs expressed in rice protoplasts or stable transgenic lines

    • Colocalization with organelle markers using confocal microscopy

    • Immunolocalization with specific antibodies

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with potential interacting proteins

    • Bimolecular fluorescence complementation (BiFC)

  • Functional analysis:

    • CRISPR/Cas9-mediated gene knockout

    • RNAi-mediated gene silencing

    • Overexpression studies using constitutive or inducible promoters

    • Phenotypic characterization under various stress conditions (particularly salt stress)

  • Biochemical characterization:

    • Vesicle trafficking assays

    • Membrane fusion assays

    • Post-translational modification analysis

How can genomic approaches be utilized to understand SCAMP2's evolutionary significance in rice?

Genomic approaches for investigating SCAMP2's evolutionary significance include:

  • Comparative genomics analysis:

    • Align SCAMP2 sequences across rice varieties and related grass species

    • Identify conserved regions that suggest functional importance

    • Analyze syntenic regions to understand genomic context

  • Phylogenetic analysis:

    • Construct phylogenetic trees of SCAMP family members across plant species

    • Determine orthologous and paralogous relationships

    • Estimate divergence times to correlate with speciation events

  • Analysis of selection pressure:

    • Calculate Ka/Ks ratios to determine selective pressure on the SCAMP2 gene

    • Identify sites under positive or purifying selection

  • Study of duplication events:

    • Analyze the contribution of SCAMP2 to the extensive gene duplications observed in rice genomes

    • Determine if SCAMP2 originated from the ancient whole-genome duplication event identified in rice or from more recent segmental duplications

Genomic analysis reveals that rice genomes have undergone significant duplication events, with at least 18 distinct pairs of duplicated segments covering 65.7% of the genome. These duplications provide raw material for gene genesis and contribute to functional diversification within gene families like SCAMPs .

What roles might SCAMP2 play in rice stress responses, and how can this be experimentally determined?

Based on research findings related to other rice genes and proteins, SCAMP2 may be involved in stress responses, particularly salt stress tolerance. To investigate this hypothesis:

  • Expression analysis under stress conditions:

    • qRT-PCR analysis of SCAMP2 expression under various abiotic stresses

    • RNA-seq analysis to identify co-expressed genes during stress

    • Promoter analysis to identify stress-responsive elements

  • Genetic association studies:

    • GWAS analysis using diverse rice germplasm (similar to the approach used for salt tolerance genes)

    • Haplotype analysis to identify superior alleles for stress tolerance

    • Identification of SNPs in SCAMP2 that correlate with stress tolerance phenotypes

  • Functional validation:

    • Generation of SCAMP2 overexpression and knockout lines

    • Phenotypic evaluation under stress conditions (germination rate, survival rate, biomass)

    • Measurement of physiological parameters (ion content, membrane integrity, ROS levels)

  • Mechanism investigation:

    • Study potential interaction with known stress response components (e.g., plasma membrane H⁺-ATPases, Na⁺/H⁺ antiporters)

    • Analyze vesicle trafficking patterns during stress responses

    • Investigate changes in membrane composition and dynamics

Recent GWAS studies have successfully identified genes contributing to salt tolerance in rice, such as LOC_Os11g29490 (encoding a plasma membrane ATPase) and LOC_Os01g27170 (encoding a potassium transporter). Similar approaches could reveal potential roles for SCAMP2 in stress adaptation mechanisms .

How does post-translational modification affect SCAMP2 function and interaction with other proteins?

Post-translational modifications (PTMs) likely play crucial roles in regulating SCAMP2 function:

  • Identification of PTM sites:

    • Mass spectrometry analysis of purified recombinant or native SCAMP2

    • Prediction of potential modification sites using bioinformatics tools

    • Site-directed mutagenesis of predicted PTM sites

  • Functional impact of phosphorylation:

    • Identification of kinases that phosphorylate SCAMP2

    • In vitro kinase assays with purified components

    • Generation of phosphomimetic and phosphodeficient mutants

    • Analysis of how phosphorylation affects SCAMP2 localization and function

  • Other potential modifications:

    • Ubiquitination analysis to determine protein turnover regulation

    • Glycosylation analysis to understand membrane association properties

    • S-acylation assessment to determine membrane targeting mechanisms

  • Interaction proteomics:

    • Comparative interactome analysis of wild-type vs. PTM-mutant SCAMP2

    • Temporal analysis of interaction networks during stress responses

    • Spatial analysis of interactions in different cellular compartments

What are the main challenges in purifying active recombinant SCAMP2 and how can they be overcome?

Purifying active recombinant SCAMP2 presents several challenges:

  • Membrane protein solubility issues:

    • Challenge: As a membrane protein, SCAMP2 has hydrophobic domains that can cause aggregation.

    • Solution: Use specialized detergents (CHAPS, DDM, or Triton X-100) during extraction and purification; consider using fusion tags that enhance solubility (MBP, SUMO).

  • Maintaining native conformation:

    • Challenge: Loss of native structure during purification.

    • Solution: Optimize buffer conditions (pH, salt concentration, glycerol percentage); use gentle purification methods; consider on-column refolding protocols.

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for E. coli; use specialized expression strains (C41/C43); consider expression in insect cells or yeast systems for improved folding.

  • Protein stability issues:

    • Challenge: Rapid degradation during purification and storage.

    • Solution: Include protease inhibitors during purification; optimize storage conditions with stabilizing agents (glycerol, trehalose); lyophilize with appropriate excipients.

  • Functional assay development:

    • Challenge: Verifying that purified protein retains functional activity.

    • Solution: Develop in vitro assays for membrane binding or vesicle formation; use liposome reconstitution to test membrane integration capabilities .

How can researchers troubleshoot expression and purification issues specific to recombinant SCAMP2?

IssuePotential CausesTroubleshooting Steps
No expression detectedToxicity to host cells, inefficient transcription/translationTry lower induction temperature (16-20°C), reduce IPTG concentration, use different E. coli strains, check construct integrity
Protein in inclusion bodiesRapid expression, improper foldingUse lower growth temperature, add solubilizing agents (sorbitol, glycerol), co-express with chaperones
Poor binding to affinity resinTag inaccessibility, improper buffer conditionsAdjust imidazole concentration, try different lysis conditions, ensure proper pH, verify tag is not cleaved
Impurities in final productNon-specific binding, protein degradationIncrease washing stringency, add additional purification steps, use fresh protease inhibitors
Low activity after purificationDenaturation, loss of cofactorsTest different buffer compositions, add potential cofactors, verify proper refolding
Precipitation during storageAggregation, freeze-thaw damageAdd stabilizing agents, optimize protein concentration, aliquot to avoid repeated freeze-thaw cycles

For optimal results, consider adapting the protocols used for other rice SCAMP proteins, which typically involve storage in Tris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What experimental designs are most suitable for investigating SCAMP2's role in rice cellular processes?

Optimal experimental designs include:

  • Genetic approaches:

    • CRISPR/Cas9 knockout lines with appropriate controls

    • Inducible RNAi lines to study temporal effects

    • Tissue-specific or stress-inducible promoters for targeted expression

    • Complementation studies with wild-type and mutant versions

  • Cell biology approaches:

    • Transient expression in protoplasts for rapid screening

    • Stable transgenic lines for whole-plant studies

    • FRET-based sensors to monitor protein interactions in real-time

    • Live-cell imaging with photoactivatable fluorescent proteins

  • Biochemical approaches:

    • In vitro reconstitution systems with purified components

    • Artificial membrane systems to study trafficking

    • Pull-down assays with domain-specific mutants

    • Crosslinking mass spectrometry for structural studies

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify SCAMP2-associated pathways

    • Comparative analysis across stress conditions and developmental stages

    • Machine learning approaches to predict functional relationships

How can researchers effectively design comparative studies between SCAMP2 and other SCAMP family members?

To design effective comparative studies:

  • Sequence-based analyses:

    • Multiple sequence alignment of all rice SCAMP proteins

    • Identification of conserved and variable regions

    • Molecular modeling to predict structural differences

    • Domain-swapping experiments to test functional conservation

  • Expression pattern comparison:

    • Tissue-specific expression analysis using qRT-PCR or reporter constructs

    • Co-expression network analysis across multiple conditions

    • Response to different stresses and developmental cues

    • Single-cell RNA-seq to identify cell-type specificity

  • Functional redundancy testing:

    • Generation of single and multiple SCAMP knockouts

    • Complementation assays with different SCAMP family members

    • Chimeric protein analysis to identify functional domains

    • Phenotypic analysis under multiple growth conditions

  • Protein interaction landscape:

    • Comparative interactome analysis of different SCAMPs

    • Competitive binding assays to identify shared partners

    • Temporal dynamics of interactions during stress responses

    • Spatial distribution using super-resolution microscopy

SCAMP4 and SCAMP6 data from the search results can serve as valuable reference points for designing these comparative studies, as they provide detailed information on protein sequences, gene structures, and expression conditions .

What emerging technologies could advance our understanding of SCAMP2 function in rice?

Several cutting-edge technologies show promise for SCAMP2 research:

  • CRISPR-based technologies:

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for precise modifications with minimal off-target effects

    • CRISPR activation/interference for modulating expression without genetic modification

    • CRISPR screens in rice protoplasts for high-throughput functional analysis

  • Advanced imaging techniques:

    • Super-resolution microscopy (PALM, STORM) for nanoscale localization

    • Light-sheet microscopy for whole-tissue imaging with reduced phototoxicity

    • Cryo-electron microscopy for structural studies of membrane complexes

    • Correlative light and electron microscopy for integrating functional and ultrastructural data

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-specific expression patterns

    • Single-cell proteomics to study protein level variation

    • Spatial transcriptomics to preserve tissue context

  • Systems biology approaches:

    • Multi-omics integration using machine learning

    • Metabolic flux analysis to understand impacts on cellular metabolism

    • Network modeling to predict system-level responses to SCAMP2 perturbation

How might understanding SCAMP2 function contribute to improving rice stress tolerance and yield?

SCAMP2 research could impact agricultural applications through:

  • Marker-assisted breeding:

    • Identification of favorable SCAMP2 haplotypes associated with stress tolerance

    • Development of molecular markers for screening germplasm

    • Introgression of superior alleles into elite cultivars

  • Genetic engineering approaches:

    • Targeted modification of SCAMP2 expression levels or activity

    • Engineering of response kinetics to environmental stressors

    • Development of stress-inducible SCAMP2 expression systems

  • Pathway engineering:

    • Modification of membrane trafficking pathways for improved stress responses

    • Engineering of secretory pathways for enhanced nutrient uptake or toxic ion exclusion

    • Optimization of vesicle trafficking for improved photosynthetic efficiency

  • Phenotypic impacts:

    • Enhanced salt tolerance during critical growth stages

    • Improved nutrient use efficiency

    • Increased yield stability under variable environmental conditions

Recent GWAS studies have demonstrated that genes involved in membrane transport processes, such as plasma membrane ATPases and potassium transporters, contribute significantly to salt tolerance in rice. As a membrane trafficking protein, SCAMP2 may similarly influence these processes and represent a valuable target for improvement .

How should researchers interpret contradictory results in SCAMP2 functional studies?

When faced with contradictory results:

  • Methodological considerations:

    • Evaluate differences in experimental systems (in vitro vs. in vivo, heterologous vs. native)

    • Consider genetic background effects in different rice varieties

    • Assess the sensitivity and specificity of detection methods

    • Examine temporal and spatial variables (tissue type, developmental stage)

  • Biochemical context:

    • Analyze post-translational modification status in different experiments

    • Consider protein complex formation and interaction dependencies

    • Evaluate buffer conditions and their physiological relevance

    • Assess the impact of tags or fusion proteins on native function

  • Functional redundancy:

    • Investigate compensation by other SCAMP family members

    • Consider the presence of parallel pathways with overlapping functions

    • Examine the effects of experimental perturbations on related proteins

  • Statistical and reporting considerations:

    • Carefully evaluate statistical power and experimental replication

    • Consider publication bias toward positive results

    • Implement blinded analysis protocols when possible

    • Use standardized reporting formats for methodological details

What statistical approaches are most appropriate for analyzing SCAMP2 expression data under various experimental conditions?

Appropriate statistical approaches include:

  • For differential expression analysis:

    • Parametric tests (t-test, ANOVA) with appropriate post-hoc corrections for multiple conditions

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

    • Linear mixed models to account for random effects in complex experimental designs

    • Bayesian approaches for integrating prior knowledge and handling uncertainty

  • For time-series data:

    • Repeated measures ANOVA for balanced designs

    • Linear mixed models for unbalanced designs

    • Functional data analysis for continuous time-series

    • Change-point analysis to identify significant shifts in expression patterns

  • For multi-dimensional data:

    • Principal component analysis (PCA) for dimensionality reduction

    • Hierarchical clustering to identify expression patterns

    • Network inference methods to identify regulatory relationships

    • Machine learning approaches for pattern recognition and prediction

  • For spatial expression data:

    • Spatial statistics to identify tissue-specific patterns

    • Image analysis pipelines for quantifying expression from microscopy

    • Spatial transcriptomics analysis workflows

    • Integration of spatial and temporal data using tensor decomposition methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.