Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 3 (SCAMP3)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant SCAMP3 is expressed in E. coli and purified under stringent conditions:

ParameterSpecification
Expression SystemEscherichia coli
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% Trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionSterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Functional Roles in Cellular Processes

SCAMP3 is integral to secretory and endosomal pathways, with roles in:

  • Vesicle Formation: Facilitates budding of vesicles through interactions with TSG101 (ESCRT-I complex) .

  • Protein Trafficking: Regulates sorting of receptors like EGFR by modulating ubiquitination and endosomal recycling .

  • Stress Responses: Linked to oxidative phosphorylation and chromatin remodeling in stress adaptation .

In rice, SCAMP3 homologs are part of a conserved gene family involved in membrane dynamics, with orthologs in Arabidopsis thaliana and humans .

Key Studies

  1. Viral Budding Mechanism

    • SCAMP3 is essential for WW domain-mediated budding of virus-like particles (WAEVs). Knockout experiments abolished vesicle production, which was rescued by wild-type SCAMP3 but not PPAA mutants .

  2. Cancer Biomarker Potential

    • In hepatocellular carcinoma (HCC), SCAMP3 overexpression correlates with advanced tumor stages (stage 3/4) and poor survival. It interacts with SOCS2 (negative regulator) and ncRNAs like SBF2-AS1 .

  3. Evolutionary Conservation

    • SCAMP3 shares functional domains with A. thaliana and human homologs, suggesting conserved roles in vesicle trafficking across eukaryotes .

Comparative Analysis Across Species

SpeciesSCAMP3 HomologKey Features
Oryza sativaQ60EA5Full-length, His-tagged; used in membrane studies
Homo sapiensNP_057080.1Linked to endocytosis and cancer progression
Arabidopsis thalianaAT1G61250Involved in secretory pathway regulation

Future Research Directions

  • Mechanistic Studies: Elucidate SCAMP3’s role in plant stress responses using CRISPR-edited rice lines.

  • Therapeutic Exploration: Investigate SCAMP3 inhibitors for cancer therapy, leveraging its overexpression in HCC .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will accommodate your requests if possible.
Lead Time
Delivery times can vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
SCAMP3; Os05g0503000; LOC_Os05g42330; OsJ_19111; OSJNBa0017K09.16; OSJNBb0048K05.1; Secretory carrier-associated membrane protein 3; Secretory carrier membrane protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SCAMP3
Target Protein Sequence
MAGKHGRNGFEDDDVNPFAGGSVPPANNSRLPPLSHEPADFYNVDIPLDSSKDLKKKEKE LQAMEAELNKRERELKRKEEAAAQAGIVIEDKNWPPFFPLIHHNISNEIPIHLQRMQYLA FSSFLGLAACLFWNIIATTTAWVKGEGVIIWLLAIIYFISGVPGAYVLWYRPLYNAMRTE SALKFGWFFLFYLIHIIFCVWAAVAPPFPFKGKSLAGILPAIDVIGRSAIVGIFYFVGFG LFCLESLLSIGVIQQVYMYFRGSGKAAEMKREAARGALSSAF
Uniprot No.

Target Background

Function
This protein is likely involved in membrane trafficking.
Database Links
Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What is SCAMP3 and what is its role in rice cellular processes?

SCAMP3 is a member of the SCAMP family of integral membrane proteins found in secretory and endocytic carriers in rice (Oryza sativa). It plays essential roles in vesicle formation, protein trafficking, and stress responses within plant cells. Specifically, SCAMP3 facilitates budding of vesicles through interactions with components like TSG101 in the ESCRT-I complex and regulates the sorting of receptors by modulating ubiquitination and endosomal recycling. In rice and other plant systems, SCAMPs are involved in membrane dynamics at the plasma membrane and in mobile cytosolic organelles, contributing to fundamental cellular processes related to secretion and endocytosis .

The SCAMP family is evolutionarily conserved across species, with homologs identified in Arabidopsis thaliana and humans, indicating their fundamental importance in cellular function across diverse eukaryotes . Within rice cells, SCAMP proteins localize to both the plasma membrane and mobile cytosolic organelles distinct from the Golgi apparatus and multivesicular bodies, suggesting specific roles in particular membrane trafficking pathways .

How does rice SCAMP3 differ structurally from other SCAMP family members?

Rice SCAMP3 belongs to a conserved protein family that shares common structural features while maintaining isoform-specific domains. While the search results don't provide specific structural information about SCAMP3, related research on rice SCAMP1 indicates that these proteins typically contain conserved regions including NPF repeats and conserved loop regions . Based on comparative analysis with other SCAMPs, we can infer that SCAMP3 likely shares the characteristic four transmembrane domains and cytoplasmic N- and C-terminal domains found in other SCAMP family members .

Sequence alignment studies across species reveal high similarity (>80% at the amino acid level) among plant SCAMPs, though rice SCAMPs may contain additional sequences at the N-terminus compared to animal SCAMPs . The evolutionary conservation of SCAMP proteins suggests that SCAMP3 maintains core functional domains while potentially having specialized regions that confer isoform-specific functions within the rice cellular environment.

What expression patterns does SCAMP3 exhibit in different rice tissues and developmental stages?

RNA-seq analysis across different rice tissues (roots, shoots, leaves, flowers, and developing seeds) and developmental stages would provide valuable insights into transcriptional regulation of SCAMP3. This could be complemented with quantitative PCR to validate expression patterns. At the protein level, tissue-specific Western blotting using SCAMP3-specific antibodies similar to those developed for SCAMP1 would confirm whether transcript levels correlate with protein abundance . Additionally, transgenic rice lines expressing fluorescently-tagged SCAMP3 under native promoters would allow visualization of expression patterns in situ.

How do post-translational modifications affect SCAMP3 function in rice cellular trafficking?

Post-translational modifications (PTMs) likely play crucial roles in regulating SCAMP3 function, although specific data on rice SCAMP3 modifications are not detailed in the search results. Based on knowledge of related proteins, researchers should investigate several potential modifications that may regulate SCAMP3 activity, localization, and protein-protein interactions.

Phosphorylation sites may exist within the cytoplasmic domains of SCAMP3, potentially regulated by stress-responsive kinases given SCAMP3's role in stress responses. Ubiquitination is another critical modification to investigate, particularly given SCAMP3's involvement in regulating receptor ubiquitination and endosomal recycling. Researchers should employ mass spectrometry-based approaches to identify PTM sites, followed by site-directed mutagenesis to create phospho-mimetic or phospho-dead variants to assess functional consequences.

Additionally, the creation of rice cell lines expressing tagged SCAMP3 variants with mutations at potential PTM sites would allow researchers to monitor how modifications affect subcellular localization, protein-protein interactions, and trafficking dynamics under various environmental conditions and developmental stages.

What protein complexes does SCAMP3 form during vesicle formation and trafficking in rice cells?

SCAMP3 likely participates in multiple protein complexes that facilitate vesicle formation and trafficking. While specific rice SCAMP3 interaction partners are not detailed in the search results, we can infer potential interactions based on related research and evolutionary conservation.

SCAMP3 has been shown to interact with TSG101, a component of the ESCRT-I complex involved in vesicle budding. To comprehensively identify SCAMP3 interactors in rice, researchers should employ affinity purification coupled with mass spectrometry (AP-MS) using tagged SCAMP3 as bait. Complementary approaches include yeast two-hybrid screening and bimolecular fluorescence complementation to validate direct protein-protein interactions in vivo.

Temporal analysis of these interactions during different trafficking events would be particularly valuable. Researchers could synchronize trafficking events using temperature shifts or chemical inhibitors, then capture SCAMP3 complexes at defined time points to build a dynamic interaction network. Functional validation of key interactions through CRISPR-Cas9 knockout or RNAi-mediated silencing would establish the physiological relevance of identified complexes.

How does SCAMP3 contribute to rice stress adaptation mechanisms?

SCAMP3 has been linked to oxidative phosphorylation and chromatin remodeling in stress adaptation responses, suggesting it may play important roles in rice resilience to environmental challenges. To fully characterize SCAMP3's contribution to stress adaptation, researchers should pursue several complementary approaches.

Comparative transcriptomic and proteomic analyses of wild-type rice versus SCAMP3 knockout or overexpression lines under various stress conditions (drought, salinity, temperature extremes, pathogen exposure) would reveal stress-specific response pathways regulated by SCAMP3. Metabolomic profiling would further identify whether SCAMP3 influences stress-responsive metabolic pathways.

Detailed phenotypic characterization of SCAMP3-modified plants under stress conditions would establish physiological relevance. Researchers should assess parameters including growth rates, photosynthetic efficiency, reactive oxygen species levels, and specific stress marker accumulation. Additionally, chromatin immunoprecipitation sequencing (ChIP-seq) could identify genomic regions affected by SCAMP3-associated chromatin remodeling during stress, connecting SCAMP3 activity to transcriptional reprogramming mechanisms.

Stress ConditionPotential SCAMP3-Mediated ResponsesExperimental Approaches
Oxidative StressROS signaling, membrane repairH₂O₂ treatment, lipid peroxidation assays
DroughtVesicle trafficking alterations, ABA signalingWater withholding, stomatal conductance measurement
SalinityNa⁺/K⁺ homeostasis, endocytosis of ion transportersSalt treatment, electrophysiology
Pathogen AttackSecretion of defense compounds, receptor endocytosisPathogen inoculation, defense gene expression analysis

What are the optimal expression systems and purification strategies for obtaining functional recombinant rice SCAMP3?

The recombinant SCAMP3 from Oryza sativa subsp. japonica can be successfully expressed in Escherichia coli as described in the search results. For optimal expression and purification, researchers should consider the following comprehensive approach:

Expression systems should be selected based on research objectives. While E. coli provides high yield and is suitable for structural studies and antibody production, eukaryotic systems may better preserve post-translational modifications and protein folding. The search results indicate that E. coli expression yields SCAMP3 with >90% purity as determined by SDS-PAGE. For membrane proteins like SCAMP3, specialized E. coli strains (such as C41/C43 or Rosetta) may improve expression of difficult sequences.

The optimal purification strategy involves:

  • Affinity chromatography using His-tagged SCAMP3 as indicated in the search results

  • Size exclusion chromatography to remove aggregates and ensure monodispersity

  • Ion exchange chromatography for removing contaminants and endotoxins if needed

Storage recommendations include lyophilization in Tris/PBS buffer with 6% Trehalose (pH 8.0), and reconstitution in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability. Researchers should avoid repeated freeze-thaw cycles by storing at -20°C or -80°C in small aliquots.

Quality control should include SDS-PAGE, Western blotting, mass spectrometry, and functional assays to confirm proper folding and activity before experimental use.

What imaging techniques are most effective for studying SCAMP3 localization and dynamics in rice cells?

Multiple complementary imaging approaches should be employed to comprehensively characterize SCAMP3 localization and dynamics in rice cells.

Confocal fluorescence microscopy using transgenic rice cells expressing fluorescently-tagged SCAMP3 (similar to the YFP-SCAMP1 approach described for tobacco BY-2 cells) provides excellent spatial and temporal resolution for studying SCAMP3 dynamics in living cells . This approach allows visualization of SCAMP3 trafficking between membrane compartments in real-time.

For higher resolution imaging, researchers should consider:

  • Super-resolution microscopy techniques (STED, PALM, or STORM) to visualize SCAMP3 distribution below the diffraction limit

  • Immunogold electron microscopy, which has proven effective for SCAMP1 localization studies as mentioned in the search results , providing ultrastructural context for SCAMP3 localization

For dynamic studies, fluorescence recovery after photobleaching (FRAP) and photoactivation can assess SCAMP3 mobility and exchange rates between compartments. Additionally, correlative light and electron microscopy (CLEM) would allow researchers to combine the temporal resolution of live-cell imaging with the ultrastructural context provided by electron microscopy.

Colocalization studies with known markers for different cellular compartments (similar to those conducted for SCAMP1 to distinguish it from Golgi apparatus and PVC/MVB) are essential for defining the precise subcellular distribution of SCAMP3 .

How can researchers effectively generate and validate SCAMP3 knockouts or knockdowns in rice?

Creating and validating SCAMP3 loss-of-function rice plants requires careful consideration of multiple approaches to ensure specificity and completeness of gene modification.

CRISPR-Cas9 genome editing represents the most precise approach for generating SCAMP3 knockouts in rice. Researchers should design multiple guide RNAs targeting conserved exons of the SCAMP3 gene to maximize knockout efficiency. Particular attention should be paid to potential off-target effects by conducting whole genome sequencing of edited plants.

Alternative approaches include:

  • RNAi-mediated gene silencing using constructs targeting SCAMP3-specific sequences

  • TILLING (Targeting Induced Local Lesions IN Genomes) to identify point mutations in SCAMP3

  • T-DNA or transposon insertion lines, if available for rice SCAMP3

Validation of knockout/knockdown lines must be comprehensive, including:

  • Genomic PCR and sequencing to confirm mutations at the DNA level

  • RT-qPCR to verify reduced or absent SCAMP3 transcript levels

  • Western blotting using SCAMP3-specific antibodies (similar to the SCAMP1 antibodies described in the search results ) to confirm protein absence

  • Functional assays examining secretion, endocytosis, or stress responses to verify physiological consequences

Complementation experiments reintroducing wild-type or mutant SCAMP3 into knockout backgrounds provide definitive confirmation that observed phenotypes are specifically due to SCAMP3 loss rather than off-target effects or genetic background differences.

How can SCAMP3 research contribute to improving rice stress tolerance for agricultural applications?

SCAMP3's involvement in stress responses and membrane trafficking positions it as a potential target for improving rice stress tolerance. Researchers can translate basic SCAMP3 findings into agricultural applications through several strategic approaches.

Genetic engineering strategies might include:

  • Overexpression of native or enhanced SCAMP3 variants in elite rice cultivars

  • Promoter modifications to optimize SCAMP3 expression under specific stress conditions

  • Targeted modifications of SCAMP3 regulatory domains to enhance specific stress response pathways

Phenotypic evaluation of SCAMP3-modified plants should assess multiple stress tolerance parameters, including:

  • Survival rates under severe stress conditions

  • Yield components under moderate chronic stress

  • Recovery capability after stress removal

  • Nutritional quality of grains produced under stress conditions

Researchers should also investigate potential trade-offs between enhanced stress tolerance and other agronomic traits such as yield potential, disease resistance, and grain quality under non-stress conditions. Field trials in multiple environments would be essential for validating laboratory findings and assessing performance under real-world conditions.

Engineering StrategyPotential BenefitsConsiderations
SCAMP3 OverexpressionEnhanced trafficking during stressPossible developmental alterations
Stress-inducible SCAMP3 expressionTargeted activation only when neededPromoter selection specificity
SCAMP3 variant with enhanced TSG101 bindingImproved vesicle formation during stressPotential disruption of normal trafficking
Modification of SCAMP3 phosphorylation sitesFine-tuned stress response activationRequires detailed knowledge of regulatory PTMs

What insights can SCAMP3 research provide for understanding fundamental membrane trafficking mechanisms across species?

SCAMP3 research in rice offers valuable comparative insights for understanding fundamental membrane trafficking mechanisms across different species. The evolutionary conservation of SCAMP proteins across plants and animals, as noted in the search results , suggests they serve core cellular functions that have been preserved throughout eukaryotic evolution.

Comparative studies between rice SCAMP3 and its homologs in other species could reveal:

  • Conserved functional domains that represent fundamental trafficking machinery

  • Species-specific adaptations that reflect unique cellular environments

  • Evolutionary innovations in trafficking pathways between plants and animals

Researchers should employ phylogenetic analyses combined with functional characterization to map the evolutionary trajectory of SCAMP functions. Domain swapping experiments between rice SCAMP3 and homologs from other species would identify which regions confer species-specific functions versus universal trafficking capabilities.

Additionally, heterologous expression of rice SCAMP3 in animal cells (and vice versa) could determine the extent of functional conservation across kingdoms. Such cross-species complementation studies would reveal whether core SCAMP functions are interchangeable despite billions of years of evolutionary divergence.

How might systems biology approaches advance our understanding of SCAMP3's role in rice cellular networks?

Systems biology approaches offer powerful frameworks for understanding SCAMP3's integration within broader cellular networks. Researchers should consider multiple systems-level strategies to contextualize SCAMP3 function.

Multi-omics integration combining transcriptomics, proteomics, metabolomics, and interactomics data from wild-type and SCAMP3-modified rice would provide a holistic view of SCAMP3's influence across cellular systems. Network analysis algorithms could then identify key pathways and regulatory hubs connected to SCAMP3 function.

Mathematical modeling of membrane trafficking dynamics incorporating SCAMP3 parameters would allow in silico prediction of trafficking outcomes under varying conditions. These models could be validated through experimental perturbations and refined iteratively.

Researchers should also consider:

  • Single-cell approaches to capture cell-type specific SCAMP3 functions

  • Temporal analyses across developmental stages and stress responses

  • Comparative systems analysis across different rice varieties with varying stress tolerance

The integration of these approaches would move beyond reductionist views of SCAMP3 function to understand its role as a component of complex, interconnected cellular systems responding to environmental challenges and developmental cues.

What potential biotechnological applications exist for recombinant SCAMP3 beyond basic research?

While maintaining focus on academic research applications rather than commercial considerations, several biotechnological applications for recombinant SCAMP3 warrant investigation.

Recombinant SCAMP3 could serve as a valuable tool for developing plant-specific membrane trafficking modulators. Researchers could engineer peptide inhibitors or enhancers based on SCAMP3 interaction domains that specifically target plant trafficking pathways, providing new experimental tools for plant biology.

Additionally, SCAMP3's role in stress responses suggests potential applications in:

  • Biosensor development for monitoring plant stress responses in agricultural settings

  • Screening platforms for identifying chemical compounds that enhance stress tolerance

  • Biomarker development for early detection of plant stress conditions

The relationship between SCAMP proteins and viral budding mechanisms noted in the search results also suggests potential applications in plant viral resistance. Engineered SCAMP3 variants might interfere with viral propagation pathways, offering novel approaches to developing virus-resistant crops through precise molecular intervention rather than broad genetic modification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.