Recombinant Oryza sativa subsp. japonica Two pore potassium channel a (TPKA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please specify your needs when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on your purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
TPKA; KCO1; Os03g0752300; LOC_Os03g54100; OJ1112_G08.7; OsJ_12594; OSJNBa0032E21.10; OSJNBa0047E24.7; Two pore potassium channel a; Two K(+ channel a; Calcium-activated outward-rectifying potassium channel 1; OsKCO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-347
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TPKA
Target Protein Sequence
MDDNSIQQSLLADNPNVLQRKPSEGVNRFRRCRSTPSTDPLQGPPEKGSSVKAKELFKEM RPSFRLVGLLLFIYLLVGVLAFYAVMDEISGKRTNRVLDALYFCVVTMTTVGYGDLVPNN DTTKLLACAFVFMGMAVVALFVSKVADYLVEKQEVLFFKALHTNLKGGETKMLRAIETNR IKYKFYTNALLLVLSIISGTVFLWKVEKLSLVDSFYCVCATITTLGYGDKSFSSKLGRVF AVFWIITSTIIMAQFFMYLAEIYTERRQKMLANWVLTRKMTKMDLEAADLDDDRQVGAAE FVVYKLKELGKINQEEISSFLEEFEKLDVDHSGTLSPYDLTLAQSAQ
Uniprot No.

Target Background

Function
This protein is a highly selective inward-rectifying potassium channel specifically located in the tonoplast of large vacuoles. It functions independently of the voltage difference across the membrane.
Database Links
Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast of large vacuoles.

Q&A

What is TPKa and what is its fundamental role in rice?

TPKa belongs to the two-pore potassium (TPK) channel family in Oryza sativa and plays a crucial role in maintaining potassium homeostasis within plant cells. It functions as a vacuolar K+ ion channel predominantly expressed in the lytic vacuole (LV) tonoplast. TPKa exhibits electrophysiological properties characterized by inward rectification and voltage independence, contributing to the regulation of cytosolic and vacuolar K+ concentrations essential for numerous cellular processes . As potassium is a major nutrient for plant growth and development, TPKa's function in K+ transport and storage is fundamental to rice physiology and stress responses.

How does TPKa differ structurally and functionally from TPKb in rice?

Despite high sequence similarity and comparable electrophysiological properties (both showing inward rectification and voltage independence), TPKa and TPKb differ primarily in their subcellular localization:

FeatureTPKaTPKb
Primary localizationLarge lytic vacuole (LV)Smaller protein storage vacuoles (PSVs)
Brefeldin A sensitivitySensitiveNot sensitive
Trafficking pathwayConventional secretory pathwayAlternative pathway
Key determinant regionC-terminal domainC-terminal domain

The differential targeting is determined by specific amino acid residues in the C-terminal domains, with three specific amino acids identified as critical for determining the ultimate vacuolar destination . This distinction in localization suggests that these channels may serve complementary roles in different vacuolar compartments despite their similar transport properties.

What experimental approaches are commonly used to characterize TPKa?

To characterize TPKa, researchers typically employ:

  • Electrophysiological methods: Patch-clamp techniques to measure channel conductance, rectification properties, and voltage dependence .

  • Subcellular localization studies: Fluorescent protein fusion constructs observed via confocal microscopy to determine spatial distribution .

  • Pharmacological assays: Using inhibitors like brefeldin A to study trafficking pathways .

  • Molecular engineering: Creation of chimeric constructs and site-directed mutagenesis to identify functional domains .

  • Heterologous expression systems: Expression in model systems such as Xenopus oocytes or yeast for functional characterization.

  • Overexpression and knockout studies: To assess physiological roles in planta, similar to approaches used for TPKb .

These methodologies are complementary and provide a comprehensive understanding of channel properties, regulation, and physiological significance.

What molecular mechanisms determine the differential vacuolar targeting of TPKa versus TPKb?

The differential vacuolar targeting of TPKa and TPKb involves complex molecular mechanisms:

  • C-terminal domain specificity: Using TPKa:TPKb chimeras, researchers have demonstrated that C-terminal domains are crucial for differential targeting. Site-directed mutagenesis identified three specific amino acid residues in the C-terminal region that determine the ultimate vacuolar destination .

  • Distinct trafficking pathways: TPKa trafficking follows the conventional secretory pathway, evidenced by its sensitivity to brefeldin A, which disrupts vesicle formation between the endoplasmic reticulum and Golgi apparatus. In contrast, TPKb trafficking is brefeldin A-insensitive, suggesting it utilizes an alternative trafficking route to reach protein storage vacuoles .

  • Vacuolar sorting signals: Though not explicitly detailed in the search results, vacuolar membrane proteins typically contain sorting signals that interact with specific adaptor proteins for appropriate trafficking.

  • Post-translational modifications: Different patterns of glycosylation or phosphorylation may influence the sorting of these channels, though this would require further investigation.

Methodologically, researchers investigating these mechanisms employ techniques such as generating chimeric constructs, site-directed mutagenesis of potential targeting motifs, and in vivo tracking of fluorescently tagged proteins in the presence or absence of inhibitors of specific trafficking pathways.

How does recombinant expression of TPKa potentially affect potassium homeostasis and stress responses?

While the search results don't provide direct information on TPKa overexpression, insights can be drawn from TPKb studies:

TPKb overexpression in rice resulted in:

  • Improved growth under low-K and water stress conditions

  • Increased K+ uptake, possibly through upregulation of AKT1 and HAK1 transporters

  • Higher K+ levels in both roots and shoots

  • Elevated cytoplasm:vacuole K+ ratio

For TPKa, similar overexpression studies would likely reveal:

  • Altered vacuolar K+ sequestration: As a lytic vacuole channel, increased TPKa expression might enhance K+ release during stress conditions, potentially improving cytosolic K+ maintenance.

  • Systemic potassium signaling: Modified expression might affect whole-plant K+ distribution and signaling networks.

  • Stress response modulation: Given potassium's role in osmotic adjustment, overexpression might confer tolerance to drought, salinity, or other abiotic stresses.

  • Metabolic consequences: Changes in K+ homeostasis could impact numerous K+-dependent enzymes and metabolic processes.

Researchers would need to employ physiological measurements (growth parameters, water status), ion content analyses (using techniques like ICP-MS or EDX), and stress tolerance assays to properly characterize these effects.

What is the evolutionary significance of TPKa in relation to potassium channels in other plant species?

The evolutionary aspects of TPKa can be examined through several lenses:

  • Conservation across species: Rice and Arabidopsis thaliana, despite diverging more than 100 million years ago, maintain similar gene structures for many proteins, including ion channels . This suggests fundamental conservation of K+ homeostasis mechanisms.

  • Lineage-specific adaptations: Both rice and Arabidopsis genomes possess lineage-specific genes that may account for species-specific differences . For TPK channels, these adaptations might reflect different environmental challenges faced by monocots versus dicots.

  • Duplication and specialization: The presence of multiple TPK isoforms (TPKa and TPKb) with differential localization suggests gene duplication followed by subfunctionalization. Natural selection appears to have played a role in determining the fate of duplicated genes in both rice and Arabidopsis, with duplication being suppressed or favored depending on gene function .

  • Selection pressure on C-terminal domains: The critical importance of C-terminal domains in determining TPKa and TPKb localization suggests this region has been under specific evolutionary pressure to develop specialized targeting mechanisms.

Methodologically, researchers investigating evolutionary aspects would employ comparative genomics, phylogenetic analyses, and studies of selection pressure (dN/dS ratios) across TPK genes in different species.

What are the technical challenges in producing and working with recombinant TPKa?

Researchers face several technical challenges when working with recombinant TPKa:

  • Membrane protein expression: As an integral membrane protein, TPKa presents challenges for heterologous expression and purification. Strategies often involve:

    • Selection of appropriate expression systems (E. coli, yeast, insect cells)

    • Use of fusion tags to improve folding and stability

    • Optimization of detergent conditions for solubilization

  • Functional reconstitution: Maintaining channel activity requires careful consideration of lipid environments and reconstitution methods, such as:

    • Incorporation into liposomes or nanodiscs

    • Planar lipid bilayer electrophysiology

    • Solid-supported membrane electrophysiology

  • Post-translational modifications: Ensuring proper processing may require eukaryotic expression systems, especially if glycosylation or phosphorylation affects function.

  • Structural characterization: Obtaining structural information through X-ray crystallography or cryo-EM presents additional challenges due to the flexibility and hydrophobicity of membrane proteins.

  • In planta verification: Confirming that recombinant protein behaves similarly to native TPKa requires careful controls and comparison of electrophysiological properties.

Researchers typically address these challenges through systematic optimization of expression conditions, purification protocols, and functional assays tailored to membrane proteins.

How can electrophysiological techniques be optimized for studying TPKa?

Optimizing electrophysiological studies of TPKa requires several specialized approaches:

  • Vacuolar patch-clamp techniques:

    • Isolation of intact vacuoles from rice cells

    • Establishment of appropriate bath and pipette solutions mimicking cytosolic and vacuolar environments

    • Selection of recording configurations (whole-vacuole vs. excised patch)

    • Temperature control for physiologically relevant measurements

  • Heterologous expression systems:

    • Expression in Xenopus oocytes for two-electrode voltage clamp

    • Development of stable mammalian cell lines for higher-throughput patch-clamp

    • Yeast expression systems for complementation studies

  • Modulation studies:

    • Systematic investigation of factors affecting channel activity:

      • pH dependence

      • Ca2+ sensitivity

      • Redox regulation

      • Interaction with regulatory proteins

  • Single-channel analysis:

    • High-resolution recordings to determine conductance states

    • Kinetic analysis of opening and closing events

    • Effect of mutations on gating properties

The inward rectification and voltage independence properties of TPKa described in the literature provide a baseline for validating these experimental approaches.

What genomic and proteomic approaches are valuable for studying TPKa regulation?

Comprehensive study of TPKa regulation benefits from integrated genomic and proteomic approaches:

  • Transcriptional regulation:

    • RNA-Seq analysis under various conditions (stress, developmental stages)

    • Chromatin immunoprecipitation (ChIP-Seq) to identify transcription factors

    • Promoter analysis and reporter gene assays

  • Post-transcriptional regulation:

    • Alternative splicing analysis

    • miRNA-mediated regulation

    • RNA stability studies

  • Post-translational modifications:

    • Phosphoproteomic analysis to identify regulated residues

    • Mass spectrometry to detect other modifications (ubiquitination, SUMOylation)

    • Site-directed mutagenesis of modified residues followed by functional testing

  • Protein-protein interactions:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid or split-ubiquitin assays

    • Bimolecular fluorescence complementation (BiFC) in planta

  • Structural consequences:

    • Molecular dynamics simulations to predict effects of modifications

    • Structural analysis of modified vs. unmodified protein

The rice genome annotation resources are particularly valuable for these approaches, with the Oryza sativa genome encoding approximately 32,000 genes , providing a comprehensive framework for regulatory studies.

How do TPKa and TPKb channels cooperatively maintain potassium homeostasis in rice?

The differential localization of TPKa (primarily in lytic vacuoles) and TPKb (predominantly in protein storage vacuoles) suggests a cooperative system for maintaining potassium homeostasis across distinct vacuolar compartments:

CharacteristicTPKa RoleTPKb RoleCooperative Function
Vacuolar typeLytic vacuole (LV)Protein storage vacuole (PSV)Complete vacuolar coverage
Size of compartmentLargeSmallHierarchical storage system
TraffickingBrefeldin A-sensitiveBrefeldin A-insensitiveDifferential regulation
Response to stressLikely major K+ reserve mobilizationEnhanced K+ homeostasis during stress Complementary stress responses

This dual-channel system likely evolved to provide:

  • Specialized K+ management: Different vacuolar compartments may require distinct K+ regulation for their specific functions.

  • Enhanced regulatory capacity: Having two independently regulated channels allows for more precise control over K+ distribution.

  • Developmental flexibility: Expression patterns may vary throughout development and in different tissues to accommodate changing K+ requirements.

  • Stress response versatility: TPKb overexpression has been shown to confer osmotic and drought tolerance , suggesting that the balance between TPKa and TPKb activities may be critical for stress adaptation.

Methodologically, researchers studying this cooperative system would benefit from simultaneous monitoring of both channels, perhaps using differentially tagged fluorescent proteins and tissue-specific or inducible promoters to manipulate expression ratios.

How does TPKa compare structurally and functionally to potassium channels in other model plant species?

Comparative analysis of TPKa with potassium channels in other plant species reveals both conserved and divergent features:

  • Structural conservation:

    • The two-pore domain architecture is conserved across plant TPK channels

    • Key functional domains likely show high sequence homology, particularly in pore regions

    • Comparative analyses between rice and Arabidopsis thaliana suggest similar sets of predicted functional domains among protein sequences

  • Functional divergence:

    • Species-specific differences in regulation and trafficking may exist

    • Rice and Arabidopsis genomes possess several lineage-specific genes that might account for observed differences between these species

    • Environmental adaptations may drive functional specialization (e.g., drought tolerance mechanisms in rice)

  • Evolutionary insights:

    • Gene duplication events appear to have been subject to natural selection in both rice and Arabidopsis, with duplication suppressed or favored depending on gene function

    • The evolutionary process has maintained similar gene structures in both species despite their divergence more than 100 million years ago

  • Regulatory conservation:

    • Systems controlling translational efficiency appear to be conserved across large evolutionary distances

    • tRNA abundance patterns show similarities between rice and Arabidopsis

Researchers comparing these channels would typically employ sequence alignment tools, homology modeling, heterologous expression to compare functional properties, and potentially complementation studies in knockout lines to test functional conservation.

What are the promising applications of TPKa manipulation for improving rice stress tolerance?

Based on findings with TPKb and our understanding of K+ homeostasis, several promising research directions for TPKa manipulation include:

  • Drought tolerance engineering:

    • Conditional overexpression of TPKa in specific tissues or under stress conditions

    • Co-expression with complementary transporters to enhance K+ utilization efficiency

    • Investigation of how modified TPKa expression affects osmotic adjustment capacity

  • Salinity tolerance improvement:

    • Manipulation of TPKa to enhance Na+/K+ discrimination

    • Testing how altered vacuolar K+ dynamics affect cytosolic Na+ exclusion mechanisms

    • Development of tissue-specific expression strategies to protect reproductive structures

  • Nutrient efficiency enhancement:

    • Engineering TPKa to function more efficiently at lower K+ concentrations

    • Exploring how TPKa modifications affect utilization of other nutrients

    • Testing growth and yield under limited K+ availability

  • Climate resilience development:

    • Combining TPKa and TPKb modifications for additive or synergistic stress protection

    • Evaluating performance under fluctuating conditions that mimic climate change scenarios

    • Assessing how channel modifications affect recovery from stress episodes

The demonstrated improvements in overexpressing TPKb lines, which showed better growth under low-K or water stress conditions and enhanced K+ uptake , suggest that similar or complementary benefits might be achieved through strategic manipulation of TPKa.

What emerging technologies could advance our understanding of TPKa dynamics in living rice cells?

Several cutting-edge technologies offer new opportunities for studying TPKa dynamics:

  • Advanced imaging techniques:

    • Super-resolution microscopy for nanoscale visualization of channel distribution

    • Light-sheet microscopy for 3D imaging of TPKa dynamics in intact tissues

    • FRET-based reporters to monitor protein-protein interactions in real-time

  • Optogenetic and chemogenetic tools:

    • Development of light-controlled TPKa variants for precise temporal manipulation

    • Engineered TPKa channels responsive to cell-permeable small molecules

    • Rapid induction systems for studying acute effects of channel activity

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-specific regulatory networks

    • Patch-seq approaches combining electrophysiology with transcriptomics

    • Cell-specific proteomics to characterize TPKa interactomes in different cell types

  • CRISPR-based approaches:

    • Base editing for precise modification of regulatory sites

    • CRISPRi/CRISPRa for reversible manipulation of expression

    • CRISPR-mediated tagging for endogenous protein tracking

  • Computational modeling:

    • Multi-scale models integrating channel dynamics with cellular physiology

    • Machine learning approaches to predict phenotypic outcomes of channel modifications

    • Virtual screening for novel modulators of channel activity

These approaches would complement the established methods used in existing research and potentially reveal previously unobservable aspects of TPKa function in the context of whole-cell potassium homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.