Recombinant Oryza sativa subsp. japonica Two pore potassium channel b (TPKB)

Shipped with Ice Packs
In Stock

Description

Comparison with Homolog TPKA

FeatureTPKB (Q8LIN5)TPKA (Q850M0)
Gene LocationChr7 (LOC_Os07g01810)Chr3 (LOC_Os03g54100)
Protein Length349 aa347 aa
FunctionTonoplast K⁺ channelPlasma membrane K⁺ channel
Expression HostCell-free systemE. coli
Key RoleVacuolar K⁺ homeostasisStress response regulation
Data derived from .

Functional Insights

TPKB functions as a calcium-activated, inward-rectifying potassium channel critical for maintaining vacuolar ion balance. Key findings include:

  • Localization: Tonoplast-specific, regulating K⁺ flux into protein storage vacuoles .

  • Mechanism: Operates independently of membrane voltage, activated by cytosolic Ca²⁺ signals .

  • Genetic Regulation: Part of the OsKCO gene family, with expression modulated under abiotic stress (e.g., salinity, drought) .

Genetic and Genomic Studies

  • QTL Associations: TPKB-linked SNPs (e.g., 12_22887040) were identified in QTLs influencing plant height (PTHT12) and flowering time, explaining 14.84% phenotypic variance in rice populations .

  • Evolutionary Conservation: Comparative genomics revealed TPKB orthologs in Arabidopsis thaliana and other cereals, highlighting conserved roles in ion homeostasis .

Biotechnological Applications

  • Recombinant Production: Available as lyophilized protein (≥85% purity) for functional assays, with vendors including CD BioSciences and Creative BioMart .

  • Experimental Use: Employed in electrophysiology studies to characterize K⁺ transport kinetics and stress-response pathways .

Future Directions

Ongoing research aims to:

  • Elucidate TPKB’s interaction with other ion transporters in vacuolar networks.

  • Engineer TPKB variants for improving rice resilience to environmental stressors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag if feasible.
Synonyms
TPKB; KCO2; Os07g0108800; LOC_Os07g01810; OJ1567_G09.108; OsJ_22819; P0585H11.123; Two pore potassium channel b; Two K(+ channel b; Calcium-activated outward-rectifying potassium channel 2; OsKCO2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-349
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TPKB
Target Protein Sequence
MAALDQQPLLHDGGDQKPPPEGAARRFRRCRTAPSSEPPPTDKDNSSAADAPPKTLFTGG GRPSFRLVGLLLVAYLLLGTIAFYLAMDHMSGTRTTRALDALYFCVVTMTTVGYGDLVPA SDAAKLLACAFVFAGVAVVGTFLSKAADYLVEKQEALLFRALHSHTMVRAMEMNKVRYKL YTAGLLLVAAVASGTVVLWKVEGMRAVDAFYCVCATVTTLGYGDRSFSSEGGRAFAVAWI TVSTVVVALFFLYAAELYTERRQRELARWVLRRRTTNMDLEAADLDGDHRVGAADFVLYK LKELGKISQEDISEFLDEFDNLDADHSGTLSPADLAAAQPTPDPPPSLR
Uniprot No.

Target Background

Function
This protein is a highly selective inward-rectifying potassium channel specifically located in the tonoplast of protein storage vacuoles. It functions independently of the voltage difference across the membrane.
Database Links

STRING: 39947.LOC_Os07g01810.1

UniGene: Os.29959

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast of protein storage vacuoles.

Q&A

What structural features differentiate TPKB from other potassium channels in Oryza sativa?

TPKB belongs to the two-pore potassium (TPK) channel family characterized by four transmembrane domains and two pore-forming regions. Its amino acid sequence contains a conserved GYGD motif in the selectivity filter, critical for K⁺ ion specificity . Unlike TPKa, which localizes to lytic vacuoles (LVs), TPKB targets protein storage vacuoles (PSVs) due to three critical residues (Asp-315, Lys-319, and Glu-322) in its C-terminal domain . Structural comparisons reveal 87% sequence homology with TPKa, yet their trafficking pathways diverge: brefeldin A disrupts TPKa transport but not TPKB .

Key Structural Comparison (TPKa vs. TPKB)

FeatureTPKaTPKB
LocalizationLytic vacuolesProtein storage vacuoles
C-terminal residuesNeutral/polarAcidic/basic
Brefeldin A sensitivityYesNo
Electrophysiological propertiesInward rectifyingInward rectifying

How does TPKB contribute to potassium homeostasis in rice under stress conditions?

TPKB mediates K⁺ flux across PSV membranes, balancing cytoplasmic K⁺ levels during abiotic stress. Overexpression lines (OXTPKB) show 23% higher shoot K⁺ content and 18% higher root K⁺ under K⁺-deficient conditions compared to wild-type . Under salinity stress (100 mM NaCl), OXTPKB lines maintain 30% greater relative growth rates by enhancing vacuolar K⁺ sequestration, reducing Na⁺/K⁺ ratios in shoots . Methodologically, ion content quantification via atomic absorption spectroscopy and electrophysiological patch-clamp assays are critical for validating these dynamics .

What experimental systems are optimal for expressing recombinant TPKB?

Recombinant TPKB is produced in transgenic rice cell cultures or whole plants using Agrobacterium-mediated transformation. The protein is expressed with a Tris-glycerol buffer system (pH 7.4) and purified via affinity chromatography, yielding ~50 µg/mL soluble protein . For functional studies, heterologous expression in Saccharomyces cerevisiae trk1Δtrk2Δ mutants restores K⁺ uptake, confirming channel activity .

How can conflicting data on TPKB’s voltage dependence be resolved?

Early electrophysiological studies reported voltage-independent gating , but recent patch-clamp assays under low Ca²⁺ (≤100 nM) revealed mild voltage sensitivity. To resolve this:

  • Standardize ionic conditions: Include 1 mM Mg²⁺ and 10 µM Ca²⁺ in pipette solutions to mimic cytoplasmic conditions .

  • Use chimeric proteins: Swap TPKB’s N-terminal domain with SKOR (Shaker-like K⁺ channel) to isolate voltage-sensing regions .

  • Apply computational modeling: Simulate pore conformations using Rosetta-Membrane to predict gating mechanisms .

What methodological pitfalls arise when studying TPKB’s interaction with calcium signaling pathways?

TPKB’s Ca²⁺ sensitivity is often conflated with CPK (calcium-dependent protein kinase) cascades. To isolate direct effects:

  • Knockout CPK9/23: Use CRISPR-Cas9 in rice protoplasts to eliminate kinase interference .

  • Fluorescent probes: Employ GCaMP6f to monitor cytosolic Ca²⁺ oscillations alongside TPKB activity .

  • EGTA chelation: Pre-treat vacuolar membranes with 5 mM EGTA to suppress Ca²⁺-mediated regulation .

Common Artifacts in Ca²⁺-TPKB Studies

ArtifactSolution
CPK cross-talkCo-immunoprecipitation with anti-CPK antibodies
Non-specific Ca²⁺ bindingMutate EF-hand motifs (e.g., D58A/E59A)
Channel rundownUse perforated-patch configurations

How do TPKB trafficking mechanisms impact experimental reproducibility?

TPKB’s PSV targeting relies on a COPII-independent pathway, unlike TPKa’s COPI-dependent route . Variability arises from:

  • Transgene insertion site: Use CRISPR to integrate TPKB at the Rosa26 locus for consistent expression .

  • Post-translational modifications: Treat protoplasts with tunicamycin (5 µg/mL) to inhibit N-glycosylation, which alters trafficking .

  • Vacuolar pH: Maintain pH 5.5–6.0 during subcellular fractionation to preserve PSV membrane integrity .

What strategies validate TPKB’s role in salt tolerance without confounding osmotic effects?

  • Iso-osmotic controls: Supplement NaCl treatments with equimolar mannitol .

  • Tissue-specific silencing: Express TPKB RNAi constructs driven by the RCc3 root-specific promoter .

  • Electrophysiological profiling: Compare K⁺ currents in root epidermal cells under 150 mM NaCl vs. 150 mM KCl using two-electrode voltage clamping .

Salt Stress Response in OXTPKB Lines

ParameterWild-TypeOXTPKB
Shoot Na⁺ (µmol/g)18.7 ± 2.112.4 ± 1.8*
Root K⁺ (µmol/g)35.2 ± 3.442.9 ± 4.1*
PSV K⁺ (mM)88 ± 11134 ± 15*
*Data from 21-day-old plants under 100 mM NaCl .

Experimental Design for TPKB Functional Analysis

  • Heterologous expression: Use Xenopus oocytes for high-yield channel incorporation (≥5 µA currents) .

  • Phenotyping: Measure stomatal conductance via porometry; TPKB-OE lines exhibit 20% reduced water loss under drought .

  • Localization: Tag TPKB with mCherry and co-stain with PSV marker α-TIP for confocal imaging .

Data Contradiction Analysis Framework

  • Step 1: Replicate assays in japonica vs. indica cultivars to exclude subspecies-specific effects.

  • Step 2: Perform Western blotting with anti-TPKB antibodies (1:1,000 dilution) to confirm protein abundance .

  • Step 3: Apply 10 µM ABA to discriminate ABA-dependent vs. -independent stress pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.