Recombinant Oryza sativa subsp. japonica Two pore potassium channel c (TPKC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant TPKC is a calcium-activated outward-rectifying potassium channel expressed in E. coli as a His-tagged protein. It corresponds to the full-length sequence (1–456 amino acids) of the native TPKC protein encoded by the Os09g0299400 locus in Oryza sativa subsp. japonica . The gene is also known as KCO3 or OsKCO3 and is implicated in regulating potassium flux across cellular membranes, a critical process for plant growth and stress responses .

Key Features:

  • Molecular Specifications:

    PropertyDetail
    SourceE. coli expression system
    TagN-terminal His tag
    Purity>90% (SDS-PAGE verified)
    StorageLyophilized powder at -20°C/-80°C; avoid freeze-thaw cycles
    ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Genetic and Functional Annotation

The TPKC gene is located on chromosome 9 of Oryza sativa subsp. japonica (UniProt ID: Q69TN4) . Comparative genomic studies highlight its role in ion homeostasis, with functional domains conserved across plant species . Key annotations include:

  • Gene Synonyms: KCO3, Os09g0299400, LOC_Os09g12790, OsKCO3 .

  • Protein Family: Two-pore potassium channels, involved in voltage-gated ion transport .

Research Applications

Recombinant TPKC is primarily utilized for:

  1. Mechanistic Studies: Investigating potassium channel structure-function relationships.

  2. Plant Physiology: Analyzing ion transport under abiotic stress (e.g., salinity, drought) .

  3. Biochemical Assays: Screening inhibitors/activators for agricultural biotechnology applications.

Limitations and Future Directions

Current data gaps include:

  • In Vivo Functional Data: No direct studies on recombinant TPKC’s physiological role in transgenic plants.

  • Structural Models: Lack of crystallographic or cryo-EM structures for TPKC.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPKC; KCO3; Os09g0299400; LOC_Os09g12790; OsJ_28764; OSJNBa0062A09.6; Two pore potassium channel c; Two K(+ channel c; Calcium-activated outward-rectifying potassium channel 3; OsKCO3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
TPKC
Target Protein Sequence
MDTEPLLSPLSPSPHLLHPLPEHAEVSTFSPPLSPCPSPASSYKERIIFGAHPPPPPPPP PPPPPPPRGRRYYRRVSGDDLDVPSCSSSPSPPSDEENPPPNPPSLFDFIGGRTNLHRSR TAPAMAPLNAAAIAAAAASGDSRNPPPPPRRPAIVLHAFLFLLAYLAMGVTFYAALPGNF TSSAGPTHPVADALYFCIVTLCTIGYGDITPATPAAKLFSISFVLIGFGFVDILLSGMVS YVLDLQEHLLITALKNPRSVRKHRHNYIFDLKKGRMRVRMKVALALTVVAICVGVGAAVL KRVENLGWLDAVYLAVMSVTTVGYGDHAFRTLAGRLFASAWLLVSTLAVARAFLYLAEMR IDKRHRAMANWVLSRDMTVSEFLAADIDNNGYVTKSEFVVYKLKEMGKISEKDIMMICDQ FQRMDSGNCGKITLSDLLESHQLVTDLNEKKKGKKS
Uniprot No.

Target Background

Function
Inward-rectifying potassium channel.
Database Links
Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does TPKC function differ from other potassium channels in rice?

TPKC belongs to the two-pore potassium (TPK) family in rice, which has distinct functional characteristics compared to other potassium channel families:

Comparison of Major K+ Channel Families in Rice:

FeatureTPK Family (TPKC)AKT/KAT FamilyOther K+ Channels
StructureTwo pore domainsSingle pore domainVariable structures
Voltage dependenceLargely voltage-independentUsually voltage-dependentVariable
RectificationInward rectificationVariableVariable
Cellular locationVacuolar membrane (tonoplast)Primarily plasma membraneVarious cellular membranes
ActivationSome activated by cytosolic factors like 14-3-3 proteinsActivated by hyperpolarization or depolarizationVarious activation mechanisms

Within the TPK family itself, TPKC has specific localization patterns that differ from TPKa and TPKb. While TPKa primarily localizes to the tonoplast of the lytic vacuole (LV) and TPKb localizes to protein storage vacuoles (PSVs), TPKC has its own distinct subcellular targeting patterns determined by specific amino acid residues in the C-terminal domain .

The electrophysiological properties of TPK channels, including TPKC, show inward rectification and voltage independence, with the presence of ATP plus 14-3-3 protein promoting channel open probability .

What are the most effective methods for expressing recombinant TPKC in heterologous systems?

For successful expression of recombinant TPKC, researchers have employed several strategies with varying effectiveness:

Expression Systems for TPKC:

  • Bacterial Expression (E. coli):

    • Transform into K+ uptake-deficient strains like LB2003

    • Use T7 expression vectors with inducible promoters

    • Grow at lower temperatures (16-20°C) after induction

    • Include osmolytes in growth media to improve protein folding

  • Plant-Based Expression:

    • Rice callus culture transformation using Agrobacterium

    • Use of maize Ubiquitin 1 promoter (ZmUbq1) for strong expression

    • Sequential transformation strategy for higher efficiency

  • Yeast Expression:

    • Use of K+ transport-deficient yeast strains

    • Expression under control of GAL1 promoter

    • Growth in media with controlled K+ concentrations

The bacterial expression in E. coli LB2003 strain has been particularly useful for functional characterization, as demonstrated with other rice TPK isoforms. This strain lacks endogenous K+ uptake systems and cannot grow on low external K+ concentrations, making it ideal for functional complementation studies with potassium channels .

When expressing in rice cells, the sequential transformation strategy has shown high efficiency, with the ZmUbq1 promoter driving strong expression in rice callus tissues and regenerated plants .

What purification protocols yield the highest purity and activity of recombinant TPKC?

The purification of functional recombinant TPKC requires careful consideration of protein stability and activity. Based on successful approaches with similar proteins, the following protocol has proven effective:

Step-by-Step Purification Protocol:

  • Cell Lysis:

    • Disrupt cells in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol

    • Include protease inhibitors (PMSF, leupeptin, pepstatin)

    • Add 1% detergent (DDM or LMNG) for membrane protein solubilization

    • Gentle agitation for 2-3 hours at 4°C

  • Initial Purification:

    • Centrifuge lysate (20,000g, 30 min) to remove insoluble material

    • Apply supernatant to Ni-NTA column if His-tagged

    • Wash with buffer containing 20-40 mM imidazole

    • Elute with buffer containing 250-300 mM imidazole

  • Secondary Purification:

    • Apply eluted protein to size exclusion chromatography

    • Use anion exchange chromatography to achieve >95% purity

    • Buffer exchange to remove imidazole during this step

  • Stabilization:

    • Final buffer: Tris-based buffer with 50% glycerol

    • Store at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

When expressed and purified correctly, recombinant TPKC should maintain its functional properties, including K+ transport activity. The purity can be assessed by SDS-PAGE, with expected purity exceeding 95%, similar to what has been achieved with recombinant human transferrin expressed in rice .

How can electrophysiological properties of TPKC channels be accurately measured?

The electrophysiological characterization of TPKC channels requires specialized techniques to measure their ion transport properties:

Patch-Clamp Analysis Protocol:

  • Preparation of Membrane Samples:

    • Express TPKC in an appropriate system (e.g., rice protoplasts, Xenopus oocytes)

    • For vacuolar patch-clamping, isolate vacuoles from transformed protoplasts

    • Alternatively, prepare artificial lipid bilayers containing purified TPKC

  • Patch-Clamp Configuration:

    • For vacuoles, use the whole-vacuole configuration

    • Standard bath solution: 100 mM KCl, 5 mM MgCl₂, 1 mM CaCl₂, 10 mM HEPES (pH 7.4)

    • Pipette solution: 100 mM KCl, 5 mM MgCl₂, 1 mM CaCl₂, 10 mM MES (pH 5.5)

  • Recording Parameters:

    • Hold at 0 mV and apply voltage steps from -100 to +100 mV

    • Record currents at 2 kHz and filter at 1 kHz

    • Analyze inward and outward conductance at -100 mV and +100 mV, respectively

  • Channel Modulation:

    • Test effects of cytosolic calcium (0-1 mM)

    • Examine effects of 14-3-3 proteins and ATP (as seen with TPKa and TPKb)

    • Test pH sensitivity by varying pH in bath and pipette solutions

Based on studies with rice TPKa and TPKb channels, expected results for TPKC would include:

  • Inward rectification (larger inward than outward current at equivalent voltages)

  • Voltage independence of open probability

  • High selectivity for K⁺ ions

  • Possible modulation by cytosolic factors like 14-3-3 proteins and ATP

The conductance values for TPKC can be compared to those obtained for TPKa (22 ± 3.6 pS outward, 54 ± 5.6 pS inward at ±100 mV) and TPKb (21 ± 3.1 pS outward, 38 ± 4.3 pS inward at ±100 mV) .

What are the recommended protocols for studying TPKC subcellular localization?

To determine the subcellular localization of TPKC, researchers can employ several complementary approaches:

Fluorescent Protein Fusion Strategy:

  • Construct Preparation:

    • Create both N-terminal and C-terminal EYFP (or GFP) fusions with TPKC

    • Use a plant expression vector with a strong promoter (e.g., CaMV 35S)

    • Include appropriate selection markers for transgenic plant generation

  • Transient Expression in Protoplasts:

    • Isolate protoplasts from rice roots and shoots

    • Transform protoplasts with the fusion constructs using PEG-mediated transformation

    • Incubate for 16-24 hours before imaging

  • Stable Transformation:

    • Generate stable transgenic rice plants expressing the fusion proteins

    • Use Agrobacterium-mediated transformation of rice callus

    • Select transformants and regenerate plants

  • Microscopy Analysis:

    • Use confocal laser scanning microscopy to visualize fluorescence

    • Employ vacuolar markers to identify different vacuole types:

      • Neutral red for lytic vacuoles (acidic pH)

      • Storage protein antibodies for protein storage vacuoles

    • Document fluorescence patterns in intact and osmotically disrupted cells

  • Co-localization Studies:

    • Co-express with known markers for different cellular compartments

    • Use organelle-specific dyes as additional controls

    • Calculate co-localization coefficients (Pearson's or Mander's)

  • Brefeldin A Sensitivity:

    • Treat cells with Brefeldin A (1-5 μg/mL) for 1-2 hours

    • Monitor changes in localization patterns

    • Compare to known BFA-sensitive (TPKa) and BFA-insensitive (TPKb) proteins

Based on studies with TPKa and TPKb, researchers would expect to see distinct patterns of localization for TPKC, potentially in specific types of vacuoles or other cellular compartments, with trafficking potentially dependent on specific C-terminal amino acid residues .

What strategies are effective for creating TPKC mutants to study structure-function relationships?

Creating TPKC mutants is crucial for understanding structure-function relationships. The following approaches have proven effective:

Site-Directed Mutagenesis Strategy:

  • Target Selection:

    • Focus on the C-terminal EF motifs which are crucial for vacuolar targeting

    • Target residues involved in ion selectivity in the pore regions

    • Identify conserved residues through sequence alignment with TPKa and TPKb

  • Mutagenesis Techniques:

    • Use PCR-based site-directed mutagenesis

    • For multiple mutations, employ overlap extension PCR

    • Consider whole-plasmid mutagenesis for single substitutions

  • Key Residues to Target:

    • Residues in the core EF loop sequence for Ca²⁺ binding studies

    • Acidic/polar residues (D, E) to non-polar ones (G, A) in the first EF motif

    • Basic/acidic substitutions (D→H) in the second EF motif

    • Three specific C-terminal amino acids identified as important for vacuolar targeting

  • Chimeric Constructs:

    • Create TPKa:TPKC and TPKb:TPKC chimeras to study domain-specific functions

    • Focus on swapping C-terminal domains, which are crucial for differential targeting

    • Design chimeras with precise junctions at domain boundaries

  • Verification Methods:

    • Sequence all constructs to confirm introduced mutations

    • Perform Western blot analysis to verify protein expression

    • Check cellular localization using fluorescent protein fusions

    • Conduct electrophysiological studies to assess functional changes

This approach has successfully identified three specific amino acids in the C-terminal regions of TPKa and TPKb that are crucial for determining their ultimate vacuolar destination , and similar strategies can be applied to TPKC to identify its key functional residues.

How can the CRISPR-Cas9 system be optimized for targeting the TPKC gene in rice?

The CRISPR-Cas9 system offers powerful tools for genetic manipulation of TPKC in rice. Based on successful approaches in rice genome editing, the following protocol can be implemented:

CRISPR-Cas9 Editing Protocol for TPKC:

  • sgRNA Design:

    • Target unique regions of the TPKC gene (Os09g0299400)

    • Design sgRNAs with minimal off-target effects using tools like CRISPR-P

    • Select target sites with NGG PAM sequences

    • Prioritize targets in early exons to maximize disruption

  • Vector Construction:

    • Use a vector system with maize Ubiquitin 1 promoter (ZmUbq1) driving Cas9

    • Express sgRNAs under rice U3 or U6 promoters

    • Include appropriate selection markers (hygromycin or Basta resistance)

  • Sequential Transformation Strategy:

    • Generate parental lines expressing Cas9 under ZmUbq1 promoter

    • Verify Cas9 expression using qRT-PCR

    • Test target locus mutation efficiency using qChop-PCR

    • Select high-efficiency parental lines for secondary transformation

  • Secondary Transformation:

    • Transform the high-efficiency Cas9 parental lines with sgRNA constructs

    • Select transformants on appropriate selection media

    • Screen for mutations using PCR-RFLP or T7E1 assay

  • Mutation Analysis:

    • Perform Sanger sequencing of PCR products

    • Clone PCR products and sequence multiple clones to identify all mutations

    • Analyze mutation patterns (insertions, deletions, substitutions)

  • Characterization of Mutants:

    • Analyze homozygous, heterozygous, and biallelic mutants

    • Perform phenotypic characterization

    • Measure potassium content in plant tissues

    • Conduct electrophysiological studies on isolated vacuoles

The sequential transformation strategy has shown high efficiency in rice, with biallelic mutations often established at the primary single-cell or early stage of transformation . For studying TPKC function, this approach can be adapted to create knockout mutants or to introduce precise modifications such as GFP tags at endogenous loci.

How does TPKC contribute to potassium homeostasis under different stress conditions?

TPKC, as a vacuolar potassium channel, plays important roles in K⁺ homeostasis under various stress conditions. Research suggests the following mechanisms:

TPKC Functions in Stress Responses:

  • Salt Stress Response:

    • TPKC likely mediates K⁺ release from vacuolar stores during salt stress

    • Expression patterns of TPK channels show differential regulation in root and shoot tissues under salt stress

    • The vacuolar K⁺ pool serves as a buffer against Na⁺ toxicity during salinity stress

  • Drought Stress:

    • Vacuolar K⁺ channels like TPKC contribute to osmotic adjustment

    • K⁺ release from vacuoles helps maintain cytosolic K⁺ concentrations during water deficit

    • Root-to-shoot K⁺ translocation involves vacuolar K⁺ fluxes

  • Nutrient Deficiency:

    • Under K⁺ limitation, TPKC may mediate the mobilization of vacuolar K⁺ reserves

    • Response to P deficiency involves K⁺ homeostasis, as shown in upland rice

    • The relative contribution of vacuolar K⁺ efflux increases during nutrient stress

Studies of rice root systems under variable phosphorus and water availability have shown that nutrient uptake and translocation are tightly linked to water uptake, with specific root types playing distinct roles . TPK channels, including TPKC, are likely involved in this coordination of nutrient and water use, particularly in the mobilization of stored K⁺ resources.

Upland rice experiments demonstrating P and water uptake patterns suggest that these processes are interconnected, with P uptake affected by water availability and root system architecture . The table below summarizes how different environmental conditions affect root mass distribution, which in turn influences K⁺ homeostasis:

Environmental ConditionRoot Mass in Topsoil (0-15 cm)Root Mass in Deep Soil (>30 cm)Impact on K+ Homeostasis
Phosphorus Deficient (NoP) + Dry Periods44.0%29.1%Increased deep soil K+ acquisition
Phosphorus Deficient (NoP) + Field Capacity56.2%23.2%Primarily topsoil K+ acquisition
Phosphorus Sufficient (PlusP) + Dry Periods42.0%29.4%Balanced K+ acquisition
Phosphorus Sufficient (PlusP) + Field Capacity55.6%15.7%Dominant topsoil K+ acquisition

This root distribution pattern suggests that TPKC and other TPK channels would be differentially regulated in different root zones depending on environmental conditions .

What experimental systems best reflect TPKC function in planta?

To accurately study TPKC function in rice plants, several experimental systems have been developed:

Recommended Experimental Systems:

  • Soil-Based Growth Systems:

    • Use soil columns with controlled nutrient distribution

    • Implement precise water regimes (field capacity vs. controlled drought periods)

    • Monitor root development in different soil layers

    • Employ rhizotrons or transparent growth systems for non-destructive root observation

  • Hydroponic Systems:

    • Design split-root setups for differential nutrient exposure

    • Control K⁺ concentrations precisely in nutrient solutions

    • Implement gradual K⁺ depletion to monitor adaptation responses

    • Combine with abiotic stress treatments (salt, osmotic stress)

  • Rice Transformation Systems:

    • Use CRISPR-Cas9 for TPKC knockouts in different rice cultivars

    • Create promoter-reporter fusions to monitor TPKC expression patterns

    • Develop conditional expression systems for temporal control

    • Complement with TPKa and TPKb studies for comparative analysis

  • Field Experiments:

    • Design appropriate plot sizes (8-25 m²) with sufficient area (≥5 m²) for harvesting

    • Implement proper blocking to account for soil heterogeneity

    • Use four replications for appropriate statistical power

    • Control for border effects with adequate plot margins

  • Tissue-Specific Analysis:

    • Isolate vacuoles from different tissues for patch-clamp studies

    • Perform cell-specific RNA extraction for expression analysis

    • Use tissue-specific promoters for targeted transgene expression

    • Monitor K⁺ fluxes with non-invasive microelectrode techniques

When conducting field experiments to study TPKC function, researchers should consider soil heterogeneity and appropriate experimental design. Statistical analysis should account for a coefficient of variation of approximately 8-10% for rice field experiments, and plots should be designed to minimize border effects .

The functional-structural modeling approach used for rice root systems could be adapted to specifically examine TPKC's role in K⁺ transport by incorporating K⁺ transport parameters into the model and simulating different environmental scenarios.

How can computational modeling predict the impact of mutations on TPKC function?

Computational modeling provides powerful tools for predicting how mutations affect TPKC structure and function:

Computational Modeling Approach:

  • Homology Modeling:

    • Identify suitable templates with known structures (e.g., human two-pore domain K⁺ channels)

    • Generate TPKC structural models using Modeller, SWISS-MODEL, or I-TASSER

    • Refine models using molecular dynamics simulations

    • Validate models against experimental data

  • Molecular Dynamics Simulations:

    • Embed TPKC models in lipid bilayer simulations

    • Run extended simulations (100-500 ns) to observe conformational changes

    • Analyze ion permeation pathways and selectivity filter conformations

    • Compare wild-type and mutant behaviors in simulated environments

  • Mutation Effect Prediction:

    • Implement in silico mutagenesis of key residues

    • Calculate free energy changes (ΔΔG) upon mutation

    • Analyze effects on protein stability and ion coordination

    • Predict changes in electrostatic surface potential

  • Machine Learning Approaches:

    • Train models on existing channel mutation data

    • Use sequence conservation, physicochemical properties, and structural features

    • Predict functional outcomes of novel mutations

    • Cross-validate predictions with experimental data

  • Virtual Screening:

    • Identify potential modulators of TPKC function

    • Dock small molecules to modeled binding sites

    • Predict binding affinities and effects on channel gating

    • Prioritize candidates for experimental validation

For specific C-terminal mutations that affect trafficking, computational approaches can predict changes in protein-protein interaction surfaces and identify potential binding partners involved in vacuolar targeting, similar to studies done with TPKa and TPKb .

How can TPKC be engineered for improved potassium use efficiency in rice?

Engineering TPKC for enhanced potassium use efficiency (KUE) in rice requires sophisticated approaches:

Engineering Strategies:

The gene targeting approach using the sequential transformation strategy has shown promise for precise genetic modifications in rice and could be applied to introduce specific modifications to TPKC for enhanced function. Additionally, understanding the root system architecture's role in nutrient acquisition provides a foundation for designing TPKC modifications that optimize K⁺ use in specific root zones.

How can researchers resolve expression and purification issues with recombinant TPKC?

Researchers often encounter specific challenges when working with recombinant TPKC. Below are common problems and their solutions:

Troubleshooting Guide:

ProblemPotential CausesSolution Strategies
Low expression levelProtein toxicity to host cellsUse tightly controlled inducible systems; grow at lower temperatures (16-20°C)
Codon biasOptimize codons for expression host; use specialized strains (e.g., Rosetta for E. coli)
mRNA instabilityCheck for rare codons; optimize 5' UTR; include ribosome binding sites
Inclusion body formationImproper foldingExpress at lower temperatures; include chaperones; use solubility-enhancing tags
Membrane protein aggregationAdd detergents during lysis; use mild solubilization conditions
Inappropriate buffer conditionsOptimize pH and ionic strength; include stabilizing agents like glycerol
Poor purification yieldInefficient solubilizationTest different detergents (DDM, LMNG, CHAPS); optimize detergent concentration
Weak binding to affinity resinsTry different affinity tags; optimize binding and washing conditions
Proteolytic degradationInclude multiple protease inhibitors; work at 4°C; reduce purification time
Loss of function after purificationDetergent-induced conformational changesTry nanodisc or liposome reconstitution; use lipid-like detergents
Loss of essential cofactorsSupplement with required ions (K⁺, Ca²⁺); add stabilizing ligands
Oxidation of critical residuesInclude reducing agents; work under nitrogen atmosphere

For rice-derived recombinant proteins, expression systems that have proven successful include rice seeds, which can express heterologous proteins at levels up to 1% of seed dry weight. Purification from rice seeds can be achieved using a one-step anion exchange chromatographic process to greater than 95% purity, as demonstrated with recombinant human transferrin .

What are the common pitfalls in interpreting electrophysiological data from TPKC studies?

Interpreting electrophysiological data from TPKC studies presents several challenges that researchers should be aware of:

Common Misinterpretations and Solutions:

  • Misattribution of Channel Activity:

    • Problem: Native channels in expression systems may contribute to recorded currents

    • Solution: Use appropriate controls (untransfected cells, inactive mutants); perform specific pharmacological block tests

  • Artificial Trafficking Patterns:

    • Problem: Overexpression may cause mislocalization of channels

    • Solution: Verify localization with multiple approaches; compare to endogenous patterns; use physiological expression levels

  • Overlooking Regulatory Factors:

    • Problem: Missing essential regulators in heterologous systems

    • Solution: Test effects of cytosolic factors (14-3-3 proteins, ATP, Ca²⁺); reconstitute with potential interacting partners

  • Technical Artifacts:

    • Problem: Seal resistance changes, electrode drift, or capacitive artifacts mimic channel activity

    • Solution: Perform rigorous controls; monitor seal resistance throughout recordings; correct for capacitive transients

  • Inappropriate Data Analysis:

    • Problem: Using analysis methods that mask or exaggerate channel properties

    • Solution: Apply appropriate filtering; use single-channel analysis when possible; employ statistical rigor

Studies of TPKa and TPKb have shown that these channels display similar conductance values but differ in their rectification properties. TPKa exhibits more pronounced inward rectification compared to TPKb, with inward conductance values of 54 pS for TPKa versus 38 pS for TPKb (at -100 mV) . When studying TPKC, it's important to distinguish its specific properties from those of other TPK isoforms and to verify that observed differences are not artifacts of the expression system.

What emerging technologies could advance our understanding of TPKC functional dynamics?

Several cutting-edge technologies hold promise for deeper insights into TPKC function:

Emerging Research Technologies:

  • Cryo-EM Structural Analysis:

    • High-resolution structural determination of TPKC in different conformational states

    • Visualization of protein-lipid interactions in native-like environments

    • Structural comparison of TPKC with TPKa and TPKb to understand isoform-specific functions

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy for precise localization in subcellular compartments

    • Single-particle tracking to monitor dynamic trafficking processes

    • FRET-based sensors to detect conformational changes in real-time

  • Optogenetic and Chemogenetic Tools:

    • Light-activated TPKC variants for temporal control of channel activity

    • Engineered TPKC responsive to synthetic ligands for precise manipulation

    • Integration with calcium imaging to study signaling networks

  • Single-Cell Transcriptomics and Proteomics:

    • Cell type-specific expression profiling in different rice tissues

    • Analysis of TPKC regulatory networks in specific cell populations

    • Protein interaction networks in different vacuolar types

  • Integrative Modeling Approaches:

    • Multi-scale modeling connecting molecular dynamics to whole-plant physiology

    • Integration of membrane transport processes with root system architecture models

    • Predictive models of K⁺ dynamics under changing environmental conditions

These technologies could help resolve outstanding questions about TPKC's specific role in rice K⁺ homeostasis and its functional distinctions from other TPK isoforms.

How might TPKC research contribute to broader understanding of ion channel evolution in plants?

TPKC research has significant implications for understanding ion channel evolution:

Evolutionary Perspectives:

  • Comparative Genomics:

    • Analysis of TPK channel diversity across plant lineages

    • Identification of conserved functional domains versus diversified regulatory elements

    • Correlation between TPK diversity and plant adaptation to different environments

  • Selection Pressure Analysis:

    • Calculation of Ka/Ks ratios for TPK genes across species

    • Identification of positively selected residues that may confer adaptive advantages

    • Comparison of selection patterns between monocots and dicots

  • Functional Divergence of Duplicated Genes:

    • Analysis of the three rice TPK isoforms (TPKa, TPKb, TPKC) as examples of subfunctionalization

    • Comparison with the five Arabidopsis TPK members

    • Correlation between genome duplication events and TPK diversification

  • Regulatory Evolution:

    • Analysis of promoter regions to understand expression pattern divergence

    • Investigation of post-transcriptional regulatory mechanisms

    • Comparison of protein-protein interaction networks across species

  • Structural Adaptation to Different Cellular Environments:

    • Comparison of TPKC with mammalian two-pore domain K⁺ channels

    • Analysis of isoform-specific adaptations to different vacuole types

    • Investigation of convergent evolution in transport mechanisms

The rice genome encodes fewer TPK isoforms (two or three) compared to Arabidopsis (five TPK channels), providing an opportunity to study how functional diversity is maintained with fewer gene family members . The distinct targeting of rice TPK channels to different vacuolar compartments suggests functional specialization that may reflect evolutionary adaptations to specific cellular requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.