Recombinant Oryza sativa subsp. japonica UPF0014 membrane protein STAR2 (STAR2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Aluminum Detoxification

STAR2 associates with STAR1 to form an ABC transporter complex critical for Al resistance:

  • Mechanism: The STAR1/STAR2 transporter facilitates UDP-glucose export to the apoplast, where it modifies cell walls to prevent Al³⁺ binding .

  • Substrate Specificity: Demonstrates high specificity for UDP-glucose, with no activity observed for other nucleotides (e.g., UDP-galactose) .

  • Localization: Predominantly expressed in root tips, the primary site of Al toxicity .

Table 2: Functional Insights from Key Studies

StudyFindingsReference
Aluminum ToleranceSTAR2 knockout lines show hypersensitivity to Al due to impaired UDP-glucose transport.
Subspecies Variationjaponica rice exhibits lower root Na⁺ content compared to indica, linked to HKT1;1 allelic differences.
Transport ActivityElectrophysiological assays confirm STAR1/STAR2-dependent UDP-glucose flux.

Research Applications of Recombinant STAR2

Recombinant STAR2 is utilized in diverse experimental contexts:

  • ELISA and Binding Assays: Used to study protein-ligand interactions, particularly UDP-glucose binding kinetics .

  • Genetic Engineering: Serves as a template for developing Al-tolerant rice varieties through CRISPR/Cas9 or overexpression approaches .

  • Structural Biology: Partial structures aid in homology modeling of UPF0014 family transporters .

Production and Quality Control

Recombinant STAR2 is produced in prokaryotic expression systems with stringent quality parameters:

  • Expression System: Escherichia coli-based systems optimized for membrane protein solubility .

  • Yield: Typical yields range from 0.5–1.0 mg/L culture, depending on induction conditions .

  • Validation: Confirmed via Western blot, mass spectrometry, and functional transport assays .

Challenges and Future Directions

  • Tag Interference: Polyhistidine tags may alter protein stability or activity, necessitating tag-free variants for certain studies .

  • Structural Resolution: Full-length STAR2 structure remains unresolved, highlighting the need for cryo-EM or X-ray crystallography efforts .

  • Ecological Impact: Engineering STAR2 into non-japonica rice subspecies could enhance Al tolerance in acidic soils, benefiting global agriculture .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format during the order placement process, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing should be avoided. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
STAR2; Os05g0119000; LOC_Os05g02750; P0496H07.22; UPF0014 membrane protein STAR2; Protein SENSITIVE TO ALUMINUM RHIZOTOXICITY 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
STAR2
Target Protein Sequence
MMASMAALLQRLLVVVNQVDPGAPGFWREFLVGMLKPVAATAVVAMAVALSFTQRLGLEG EMLYAMARAFLQLSVIGFVLQFIFTQKSAAWILLAYLFMVTVAGYTAGQRARHVPRGKHI AAVSILAGTSVTMALLVALRVFPFTPRYIIPVAGMMVGNAMTVTGVTMKKLREDVGMQRG VVETALALGATPRQATARQVRRSLVIALSPVIDNAKTVGLIALPGAMTGLIMGGASPLEA IQLQIVVMNMLMGASTVSSILSTYLCWPAFFTGAFQLNDAVFAAD
Uniprot No.

Target Background

Function
This protein associates with STAR2 to form a functional transmembrane ABC transporter required for detoxification of aluminum (Al) in roots. It has the ability to specifically transport UDP-glucose.
Database Links
Protein Families
UPF0014 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots.

Q&A

What is STAR2 protein and what is its biological significance?

STAR2 (Sensitive To Aluminum Rhizotoxicity 2) is a membrane protein encoded by the STAR2 gene in Oryza sativa subsp. japonica. It belongs to the UPF0014 membrane protein family and plays a critical role in aluminum tolerance mechanisms. The protein's name directly reflects its function in mediating resistance to aluminum toxicity in acidic soils, a significant abiotic stress factor for rice cultivation worldwide .

STAR2 has alternative gene names including Os05g0119000 and LOC_Os05g02750, with ORF name P0496H07.22. The biological significance of this protein lies in its contribution to the adaptation mechanisms that allow rice to grow in aluminum-rich acidic soils that would otherwise inhibit root growth and development .

How does STAR2 compare to other aluminum response proteins in plants?

STAR2 functions within a network of aluminum response mechanisms that have evolved in various plant species. Unlike some aluminum tolerance proteins that operate through organic acid secretion (such as MATE transporters), STAR2 appears to function through membrane-based mechanisms that potentially modify aluminum uptake or translocation .

Comparative analysis with other plant species reveals that membrane proteins involved in aluminum tolerance often share structural motifs but may have diverged functionally. Rice (Oryza sativa) varieties show significant variation in aluminum tolerance traits, potentially related to differences in STAR2 expression levels and protein functionality across subspecies .

What are the optimal expression systems for recombinant STAR2 production?

Selecting an appropriate expression system for STAR2 requires consideration of several factors, summarized in the following table:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliCost-effective, high yield, rapid productionPotential for inclusion bodies, limited post-translational modificationsLower induction temperature (16-20°C), specialized strains (C41/C43), fusion with solubility enhancers (MBP, SUMO)
Yeast (P. pastoris)Eukaryotic processing, scale-up potentialLonger production times, hyperglycosylationMethanol induction optimization, temperature control during induction phase
Insect cellsNative-like membrane protein foldingTechnically demanding, higher costOptimization of MOI, harvest timing, specialized cell lines for membrane proteins
Rice cell culturesNative environment, authentic processingLow yields, specialized expertise requiredOptimization of growth media, induction conditions specific to rice cells

For structural and functional studies of STAR2, insect cell expression systems often provide the best balance between yield and proper folding. The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term and -80°C for long-term storage, with recommendations against repeated freeze-thaw cycles .

What purification challenges are specific to STAR2 as a membrane protein?

Purification of STAR2 presents several membrane protein-specific challenges that require methodological considerations:

Membrane solubilization requires careful detergent selection, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LDAO (lauryldimethylamine oxide) typically providing good results. The purification process generally follows these steps:

  • Cell lysis under conditions that preserve membrane integrity

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using optimized detergent concentrations

  • Affinity chromatography using the integrated tag (often His6)

  • Size exclusion chromatography for final polishing

  • Quality assessment through techniques like SDS-PAGE, Western blotting, and dynamic light scattering

Critical factors affecting purification success include pH, ionic strength, temperature stability, and lipid environment. Reconstitution into lipid nanodiscs or proteoliposomes may be necessary for functional studies, as the aluminum response function likely depends on proper membrane integration .

What experimental designs are most effective for evaluating STAR2's role in aluminum tolerance?

Investigating STAR2's role in aluminum tolerance requires multi-faceted experimental approaches:

  • Genetic manipulation studies:

    • CRISPR-Cas9 knockout of STAR2 in rice

    • Overexpression lines with constitutive or inducible promoters

    • Complementation experiments with wild-type or mutated STAR2

  • Physiological assessment protocols:

    • Root growth inhibition assays at varying aluminum concentrations (50-300 μM Al3+)

    • Aluminum uptake measurements using inductively coupled plasma mass spectrometry (ICP-MS)

    • Membrane integrity evaluations using fluorescent dyes (e.g., propidium iodide)

    • Microscopic analysis of root apex damage under aluminum stress

  • Molecular mechanistic studies:

    • Evaluation of gene expression changes using qRT-PCR and RNA-seq

    • Protein localization under normal and aluminum stress conditions

    • Measurements of cytosolic aluminum levels using specific fluorescent indicators

    • Analysis of potential transport activity through electrophysiology or fluorescence-based assays

Rice varieties exhibit variable aluminum tolerance, with javanica (tropical japonica) varieties showing some distinct characteristics compared to other subspecies, potentially related to STAR2 function or regulation .

How can structural biology techniques be applied to understand STAR2 function?

Elucidating STAR2's structure-function relationship requires specialized approaches for membrane proteins:

  • Computational prediction tools provide initial insights into transmembrane topology and potential functional domains. These predictions serve as the foundation for experimental design, particularly for site-directed mutagenesis studies.

  • Experimental structural determination techniques include:

    • X-ray crystallography with membrane protein-specific crystallization techniques (lipidic cubic phase, bicelles)

    • Cryo-electron microscopy, particularly suitable for membrane proteins that resist crystallization

    • Solid-state NMR for structural information in a membrane-like environment

    • Limited proteolysis combined with mass spectrometry to identify domain boundaries and flexible regions

  • Functional correlation through targeted mutagenesis:

    • Alanine-scanning mutagenesis of predicted aluminum-binding residues

    • Charge-reversal mutations of functionally important residues

    • Domain swapping with related proteins to identify critical regions

The UPF0014 membrane protein family has not been extensively characterized structurally, making STAR2 an important target for understanding the molecular mechanism of aluminum tolerance in rice .

What omics approaches provide insights into STAR2's regulatory networks?

Multi-omics approaches reveal STAR2's position within aluminum response networks:

  • Transcriptomics approaches:

    • RNA-seq comparing wild-type and STAR2 mutant rice under aluminum stress

    • Time-course experiments to capture dynamic responses (typical timepoints: 0, 6, 12, 24, 48 hours post-exposure)

    • Single-cell transcriptomics to identify cell-type specific responses in root tissues

  • Proteomics strategies:

    • Quantitative proteomics comparing protein expression profiles with and without aluminum stress

    • Phosphoproteomics to identify post-translational modifications in response to aluminum

    • Interactomics using affinity purification-mass spectrometry to identify STAR2-interacting proteins

  • Metabolomics integration:

    • Analysis of organic acid profiles (malate, citrate) associated with aluminum tolerance

    • Lipid profiling to detect membrane composition changes

    • Secondary metabolite shifts in response to aluminum stress

  • Data integration frameworks:

    • Network analysis identifying regulatory hubs and feedback loops

    • Pathway enrichment analysis for biological process identification

    • Multi-omics data visualization tools for comprehensive understanding

Tropical japonica rice varieties show distinct gene expression patterns and variation in several important agronomic traits, which may correlate with STAR2 function and regulation in different genetic backgrounds .

How can advanced imaging techniques be optimized for studying STAR2 localization and dynamics?

Imaging STAR2 in plant cells requires specialized techniques:

  • Confocal microscopy approaches:

    • Creation of fluorescent protein fusions (GFP, mCherry) with careful verification of functionality

    • Co-localization studies with organelle markers for precise subcellular localization

    • FRAP (Fluorescence Recovery After Photobleaching) analysis for membrane mobility assessment

    • Live-cell imaging to track dynamics during aluminum exposure

  • Super-resolution techniques:

    • STED (Stimulated Emission Depletion) microscopy for sub-diffraction imaging

    • Single-molecule localization microscopy for precise positioning

    • Expansion microscopy for physically enlarged specimens

  • Sample preparation considerations:

    • Fixation protocols optimized for membrane protein preservation

    • Clearing techniques for whole-root imaging

    • Aluminum visualization using specific fluorescent probes (e.g., morin, lumogallion)

  • Quantitative analysis methods:

    • Colocalization coefficients calculation (Pearson's, Manders')

    • Intensity correlation analysis

    • 3D reconstruction and volumetric analysis

Rice cell wall structures present particular challenges for high-resolution imaging, requiring specialized protocols for membrane protein visualization in intact tissues .

What electrophysiological techniques can determine if STAR2 functions as an ion transporter?

If STAR2 functions as an ion transporter or channel, several electrophysiological approaches can be employed:

These approaches should be combined with mutagenesis of key residues to establish structure-function relationships related to aluminum transport or sensing .

What molecular techniques are effective for studying STAR2 interactions with aluminum?

Understanding how STAR2 interacts with aluminum requires specialized molecular techniques:

  • Binding assays:

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Microscale thermophoresis (MST) for binding in solution

  • Structural studies with aluminum:

    • X-ray absorption spectroscopy to determine aluminum coordination environment

    • NMR spectroscopy with aluminum isotopes to identify binding sites

    • Cryo-EM structures in the presence and absence of aluminum

  • Cellular aluminum distribution:

    • Fluorescent aluminum indicators (Morin, Lumogallion) for microscopy

    • Elemental analysis through techniques like SIMS (Secondary Ion Mass Spectrometry)

    • Synchrotron X-ray fluorescence for spatial resolution of aluminum

  • Functional correlation:

    • Site-directed mutagenesis of predicted aluminum-binding residues

    • Electrophysiological measurements in response to aluminum

    • Conformational change detection using FRET-based sensors

Rice varieties exhibit differential aluminum tolerance potentially linked to STAR2 function. Understanding the molecular basis of these differences could provide valuable insights for crop improvement strategies .

How can genetic engineering approaches be used to enhance STAR2 function for aluminum tolerance?

Engineering enhanced aluminum tolerance through STAR2 modification offers promising research directions:

  • Promoter engineering strategies:

    • Replacement with constitutive promoters for increased expression

    • Use of stress-inducible promoters for conditional expression

    • Tissue-specific promoters for targeted expression in root tissues

  • Protein engineering approaches:

    • Site-directed mutagenesis of key functional residues

    • Domain swapping with homologs from highly tolerant species

    • Directed evolution through random mutagenesis and selection

  • Genetic background considerations:

    • Introduction into sensitive rice varieties through transformation

    • CRISPR-based replacement of existing STAR2 with enhanced variants

    • Stacking with other aluminum tolerance genes for synergistic effects

  • Validation methodologies:

    • Hydroponics screening under defined aluminum concentrations

    • Field trials in acidic soils with various aluminum levels

    • Multi-generation stability assessment

InDel markers developed for various rice subspecies can be valuable tools for tracking STAR2 variants in breeding programs. These markers function like SSRs in identifying hybrids, calculating genetic distance, and gene mining across rice varieties .

How does STAR2 function differ between rice subspecies and varieties?

Rice subspecies show significant variation in aluminum tolerance that may relate to STAR2 function:

InDel markers can be valuable for tracking genetic variation in STAR2 across rice subspecies, providing tools for both research and breeding applications .

What insights from STAR2 research could apply to engineering other crop species for acid soil tolerance?

Knowledge gained from STAR2 research has broad applications for improving crop performance in acidic soils:

  • Translational research opportunities:

    • Identification of STAR2 homologs in other cereal crops

    • Engineering of functional STAR2 variants in sensitive crops

    • Development of molecular markers for selection across species

  • Comparative genomics approaches:

    • Analysis of conserved regulatory elements across species

    • Identification of subspecies-specific adaptations

    • Evolution of aluminum tolerance mechanisms

  • Biotechnology applications:

    • CRISPR-based genome editing of STAR2 homologs

    • Cisgenesis approaches using superior natural variants

    • RNAi strategies for modulators of STAR2 function

  • Agronomic implications:

    • Development of diagnostic tools for aluminum tolerance potential

    • Breeding strategies incorporating STAR2 knowledge

    • Management practices optimized for varieties with enhanced STAR2 function

Cross-species applications must consider the broader aluminum tolerance mechanisms, as STAR2 likely functions within a complex network of protective responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.