Recombinant Oryza sativa subsp. japonica UPF0392 protein Os08g0121900 (Os08g0121900, LOC_Os08g02850)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To specify a tag type, please inform us, and we will prioritize its development.
Synonyms
Os08g0121900; LOC_Os08g02850; B1203H11.32; OsJ_25865; OSJNBa0073J19.9; OSJNBa0091F23.17; Glycosyltransferase family 92 protein Os08g0121900
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os08g0121900
Target Protein Sequence
MALAAKERKLSRLGSKGSGGGGGGGSFGARGQRAPAGTQRRLFAAFFAFLFAGAVLFGAA HVIGASFRPVLKTAWPSATLNAVSSERGAQQAGMVSVDAVLPSVHIQHAVALPDHVLLML RDGSLLPASGQFECLYSPVNSSQLRRQPLSVATLPDGPSLVHCPAGPSRVAVSLSLAQSV PVAPLQWDRLVYTALIDSKDNSTVVFAKGMNLRPGRLGVPSRYECVFGRDFSKPKLVVTS PVVSAAQEIFRCVTPVRIRRYLRMTTGGKNSVNNDDKPMLVSIRTKGRGSSTLPSIAQPE PLPRYNKHWRRKAHSMCVCTMLRNQARFLREWIIYHSRIGVQRWFIYDNNSDDGIEEVLN TMDSSRYNVTRYLWPWMKSQEAGFAHCALRARESCEWVGFIDIDEFLHFPGNQTLQDVLR NYSVKPRIGELRTACHSFGPSGRTKIPKKGVTTGYTCRLAAPERHKSIVRPDALNPSLIN VVHHFHLKEGMKYVNIGQGMMLINHYKYQVWEVFKDKFSGRVATYVADWQDEENVGSRDR APGLGTKPVEPEDWPRRFCEVYDNGLKDFVQKVFTDPHTGNLPW
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase 92 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Oryza sativa subsp. japonica UPF0392 protein Os08g0121900?

The Recombinant Oryza sativa subsp. japonica UPF0392 protein Os08g0121900 (Os08g0121900, LOC_Os08g02850) is a truncated version of a glycosyltransferase family 92 protein expressed in rice (Oryza sativa). This protein belongs to the UPF0392 family, a group of proteins with poorly understood biological functions but implicated in plant metabolic pathways. The protein is part of a broader category of membrane proteins that may play important roles in cellular processes within rice.

What is the molecular structure and characteristics of this protein?

The full-length Os08g0121900 protein consists of 584 amino acids . As a member of the glycosyltransferase family 92 (GT92), this protein is potentially involved in carbohydrate biosynthesis or cell wall modification processes. The protein lacks localization signals in its partial form, causing it to remain cytosolic. When expressed recombinantly, the protein is typically produced with a His-tag for purification purposes . Stability analyses indicate that the protein requires storage at -20°C/-80°C, and repeated freeze-thaw cycles should be avoided to maintain its integrity.

How is Os08g0121900 related to other proteins in the glycosyltransferase family?

Os08g0121900 is related to other glycosyltransferase family 92 proteins found across plant species. A homologous protein has been identified in Nicotiana tomentosiformis (tobacco), designated as "glycosyltransferase family 92 protein Os08g0121900-like" (LOC104086976) . This evolutionary conservation suggests important functional roles for this protein family across different plant species. Phylogenetic analysis using tools described in proteomic studies of rice can help elucidate its relationship to other members of the glycosyltransferase superfamily .

What expression systems are optimal for producing this recombinant protein?

The protein can be produced via recombinant expression in multiple systems, each offering distinct advantages:

HostExpression Notes
E. coliCommon for high-yield production
YeastUsed for post-translational modifications
BaculovirusEmployed for complex glycosylation
Mammalian CellsEnsures proper folding and activity

Most commercial preparations utilize E. coli expression systems . For researchers requiring post-translational modifications or proper protein folding, eukaryotic expression systems may be preferable. Rice-based expression systems have also demonstrated efficiency, with yields exceeding 0.1 g/kg fresh weight, and full-length versions achieving yields up to 2.75 g/kg in rice endosperm.

How should experimental data tables be structured when working with this protein?

When designing data tables for experiments involving Os08g0121900, follow these guidelines based on scientific data table best practices:

  • Include a clear title describing the experiment (e.g., "Glycosyltransferase Activity of Recombinant Os08g0121900 Under Various pH Conditions")

  • Identify independent variables (e.g., pH, temperature, substrate concentration) and dependent variables (e.g., enzyme activity)3

  • Present data in organized columns with appropriate headers and units3

  • Include statistical measures (standard deviation, standard error) when presenting replicated experiments

  • For kinetic studies, create tables showing substrate concentration, initial velocity, and derived parameters (Km, Vmax)

For example, a glycosyltransferase activity assay table might look like:

pHTemperature (°C)Enzyme Activity (nmol/min/mg)Standard Deviation (n=3)
5.525X.XX±X.XX
6.025X.XX±X.XX
6.525X.XX±X.XX
7.025X.XX±X.XX
7.525X.XX±X.XX

What are the optimal buffer conditions and storage recommendations for working with this protein?

For reconstituting lyophilized protein, use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the default concentration used by commercial suppliers . The protein requires storage at -20°C/-80°C for stability, with reported shelf life of 6 months for liquid preparations and 12 months for lyophilized forms .

Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can compromise protein activity. When designing buffer systems for functional assays, consider that most glycosyltransferases require divalent cations (often Mg²⁺ or Mn²⁺) and appropriate pH conditions (typically pH 6.5-7.5) for optimal activity.

How does Os08g0121900 participate in plant cell wall biosynthesis and modification?

As a glycosyltransferase family 92 protein, Os08g0121900 is likely involved in cell wall-related carbohydrate metabolism. Rice cell walls contain complex polysaccharides that require various glycosyltransferases for their synthesis and modification . While the specific substrates and acceptors for Os08g0121900 have not been fully characterized, its classification suggests potential roles in transferring sugar moieties during polysaccharide assembly.

Research on rice cell wall biosynthesis has identified several key glycosyltransferases, including cellulose synthases (CESA), cellulose synthase-like proteins (CSLD), and callose synthases . Os08g0121900 may function alongside these enzymes in coordinated biosynthetic pathways. Studying its activity in comparison to well-characterized cell wall biosynthetic enzymes could provide insights into its specific role within the cell wall synthesis machinery.

What is known about the role of Os08g0121900 in stress response pathways?

Preliminary investigations suggest that Os08g0121900 may have roles in ER stress and autophagy pathways. These cellular processes are critical for plant responses to various environmental stressors. Analogous studies of structurally similar proteins, such as those conducted with SARS-CoV-2 ORF8, have provided templates for investigating stress-related functions.

Salt stress response pathways in rice involve numerous proteins that are upregulated under stress conditions. The related protein Salt stress-induced protein (SALT) in rice has been characterized as responding to salt stress , suggesting that glycosyltransferases and related proteins may have roles in stress adaptation. Further research is needed to determine whether Os08g0121900 expression or activity changes under various stress conditions and how it might contribute to stress tolerance mechanisms.

What techniques can be used to identify interaction partners of Os08g0121900?

To identify protein-protein interactions involving Os08g0121900, several complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP) using antibodies against Os08g0121900 or its epitope tag, followed by mass spectrometry analysis of co-precipitated proteins

  • Yeast two-hybrid screening using Os08g0121900 as bait against a rice cDNA library

  • Proximity-dependent biotin labeling (BioID or TurboID) with Os08g0121900 fused to a biotin ligase

  • In vitro pull-down assays using purified recombinant Os08g0121900 as bait

  • Crosslinking mass spectrometry to capture transient or weak interactions

When analyzing interaction data, it's important to validate key interactions through multiple independent methods and consider the biological context. The Patterson's D-statistics approach, used in phylogenetic studies , can be adapted to assess the significance of protein interaction networks across different experimental conditions.

How can I design experiments to characterize the glycosyltransferase activity of Os08g0121900?

To characterize the glycosyltransferase activity of Os08g0121900, design a systematic experimental approach:

  • Substrate specificity screening: Test activity with various nucleotide sugar donors (UDP-glucose, UDP-galactose, etc.) and acceptor substrates (oligosaccharides, glycoproteins)

  • Kinetic analysis: Determine enzyme kinetics parameters (Km, Vmax, kcat) using varying substrate concentrations

  • pH and temperature optima: Assess activity across a range of pH values (5.0-8.0) and temperatures (20-40°C)

  • Cofactor requirements: Evaluate the effects of different divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) and their concentrations

  • Inhibitor studies: Test the effects of known glycosyltransferase inhibitors to classify the enzyme mechanism

  • Product analysis: Use mass spectrometry or HPLC to identify and characterize the products formed

This systematic approach will provide comprehensive characterization of the enzyme's catalytic properties and help position it within known glycosyltransferase classification schemes.

What approaches can be used to study the function of Os08g0121900 in vivo?

To investigate the biological function of Os08g0121900 in vivo, consider these approaches:

  • Gene knockout/knockdown: Generate rice lines with reduced or eliminated Os08g0121900 expression using CRISPR/Cas9 or RNAi technologies

  • Overexpression studies: Create transgenic lines overexpressing Os08g0121900 to observe gain-of-function phenotypes

  • Promoter-reporter fusion: Analyze the spatial and temporal expression patterns using promoter-GUS or promoter-GFP fusions

  • Subcellular localization: Determine the precise cellular compartmentalization using fluorescently-tagged Os08g0121900

  • Phenotypic analysis: Examine mutant plants for alterations in growth, development, cell wall composition, and stress responses

  • Transcriptome analysis: Compare gene expression profiles between wild-type and mutant plants to identify affected pathways

  • Metabolomics: Analyze changes in metabolite profiles, particularly cell wall components, in mutant plants

These complementary approaches can provide insights into the biological roles of Os08g0121900 in rice growth, development, and stress responses.

How can proteomics approaches be applied to study Os08g0121900 in rice plasma membrane?

Proteomic analysis of rice plasma membrane proteins can provide valuable insights into Os08g0121900 function:

  • Plasma membrane enrichment: Isolate plasma membrane fractions using aqueous two-phase partitioning and high pH carbonate washing to remove soluble contaminants

  • Protein identification: Analyze membrane preparations using techniques such as:

    • 1D-SDS-PAGE followed by tryptic proteolysis

    • Proteolysis followed by strong cation exchange liquid chromatography

    • LC-MS/MS analysis (Gel-LC-MS/MS and 2D-LC-MS/MS approaches)

  • Quantitative proteomics: Compare protein abundance across different conditions (development stages, stress treatments) using label-free or isotope-labeled approaches

  • Post-translational modifications: Identify modifications like phosphorylation or glycosylation that may regulate Os08g0121900 activity

  • Protein complexes: Use blue native PAGE or crosslinking approaches to identify native membrane protein complexes containing Os08g0121900

When conducting proteomic studies, ensure proper validation of identified proteins through multiple peptide matches, as approximately 438 proteins can be confidently identified based on two or more matching peptides in typical rice plasma membrane preparations .

How should I approach comparative analysis with homologous proteins in other species?

When comparing Os08g0121900 with homologs in other species, follow these steps:

  • Sequence alignment: Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL to identify conserved domains and residues

  • Phylogenetic analysis: Construct phylogenetic trees to understand evolutionary relationships using maximum likelihood or Bayesian approaches

  • Domain structure comparison: Analyze protein domains across species using tools like PFAM or InterPro

  • Functional conservation testing: Compare biochemical activities of recombinant proteins from different species

  • Expression pattern analysis: Compare tissue-specific or stress-induced expression patterns across species

A particularly valuable comparison might be with the Nicotiana tomentosiformis (tobacco) homolog, glycosyltransferase family 92 protein Os08g0121900-like (LOC104086976) , which likely shares functional similarities. The comparative approach can reveal evolutionarily conserved features that may indicate functional importance.

What statistical methods are appropriate for analyzing enzyme kinetics data for Os08g0121900?

When analyzing enzyme kinetics data for Os08g0121900, consider these statistical approaches:

  • Non-linear regression: Fit data to appropriate enzyme kinetics models (Michaelis-Menten, allosteric, etc.) using software like GraphPad Prism or R

  • Lineweaver-Burk or Eadie-Hofstee transformations: Create linear plots to visualize kinetic parameters, though direct non-linear fitting is generally preferred

  • Global fitting: Simultaneously analyze multiple datasets when examining inhibition mechanisms

  • Confidence intervals: Report 95% confidence intervals for all kinetic parameters (Km, Vmax, kcat)

  • Model comparison: Use Akaike Information Criterion (AIC) or F-tests to compare different kinetic models

  • Replicate analysis: Perform experiments in triplicate and report standard errors or standard deviations

  • Outlier analysis: Apply Grubb's test or other statistical methods to identify potential outliers

When publishing kinetics data, include both the raw data points and fitted curves, along with statistics on the goodness of fit (R² values) and parameter estimates with confidence intervals.

How can bioinformatics approaches help predict the function of this poorly characterized protein?

For poorly characterized proteins like Os08g0121900, bioinformatics can provide valuable functional predictions:

  • Sequence-based prediction: Use tools like BLAST, PSI-BLAST, and HHpred to identify distant homologs with known functions

  • Structural prediction: Generate 3D structural models using AlphaFold2 or I-TASSER, then compare with structures of characterized glycosyltransferases

  • Functional domain analysis: Identify catalytic motifs and substrate-binding regions through comparison with characterized glycosyltransferases

  • Gene co-expression networks: Analyze co-expression patterns with genes of known function across different tissues and conditions

  • Genomic context analysis: Examine neighboring genes in the rice genome that may be functionally related

  • Enrichment analysis: Apply Gene Ontology (GO) or KEGG pathway enrichment to identify over-represented functional categories

  • Protein-protein interaction prediction: Use tools like STRING to predict functional associations

These computational approaches can generate testable hypotheses about Os08g0121900 function, guiding experimental design for biochemical and genetic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.