Recombinant Oryza sativa subsp. japonica UPF0496 protein 1 (Os03g0199100, LOC_Os03g10240)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os03g0199100; LOC_Os03g10240; OsJ_009426; UPF0496 protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os03g0199100
Target Protein Sequence
MGNSSSSGSHRPPRPASSESALPPAAAAAEELSSYEAACRSDPELRTFDTTLQRRTSRAI STLAVGVEVRSLSLESLREVTGCLLDMNQEVVRVILDCKKDIWKSPELFDLVEDYFESSL HTLDFCTALDKCLKRARDSQLLLHVALQRFDDEEDNDAAAAGQEDAAPSARYARTLHELR QFKAAGDPFTEEFFSAFQAVYRQQLTMLEKLQQRKHRLDKKVRAIKAWRRVSSIIFATTF AAVLICSVVAAAIAAPPVAAALAAAASIPVGSMGKWIDSLLKGYQDALRGQKEVVSAMQV GTFIAIKDLDSIRVLINRVELEISSMIDCVEFAERDEEAVKFGVEEIKKKLEVFMKSVED LGEQADRCSRDIRRARTVVLQRIIRHPS
Uniprot No.

Target Background

Database Links

KEGG: osa:4331959

UniGene: Os.18318

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0496 protein 1 from Oryza sativa subsp. japonica and what is its genomic location?

UPF0496 protein 1 (Os03g0199100, LOC_Os03g10240) is a protein of unknown function (UPF) found in rice (Oryza sativa subsp. japonica). The protein is encoded by a gene located on chromosome 3 of the rice genome. While its specific molecular function is not fully characterized, it belongs to the UPF0496 family, which contains several conserved domains that suggest potential roles in cellular signaling or stress responses. Genomic analysis indicates it has homologs across various plant species, with particularly close relationships to similar proteins in other cereal grains .

What are the structural characteristics of UPF0496 protein 1?

UPF0496 protein 1 contains several conserved domains typical of this protein family. Multiple sequence alignment analyses reveal high conservation of residues in the DPBB_1 domain (amino acid residue positions 86-164), which is distinctively present across homologous proteins . The protein's structure likely includes several transmembrane regions, as suggested by its hydrophobicity profile and comparison with related proteins. Functional analysis indicates UPF0496 proteins typically have an average length of 380-410 amino acids, with several conserved motifs that may participate in protein-protein interactions or signaling cascades .

How does UPF0496 protein 1 differ from other UPF0496 family members in rice?

Rice contains multiple UPF0496 family proteins that share structural similarities but likely fulfill distinct biological functions. Comparative analysis shows:

ProteinLocus IDLength (AA)Key Differences
UPF0496 protein 1Os03g0199100~390Higher expression in vegetative tissues
UPF0496 protein 2OsI_023618408Contains additional N-terminal motifs
UPF0496 protein 3Os03g0148000378Higher expression in reproductive tissues

Phylogenetic analysis indicates that UPF0496 protein 1 is more closely related to similar proteins in other japonica rice varieties and Zea mays, while being more distantly related to homologs in other grass species like Lolium perenne and Dactylis glomerata . These differences suggest functional specialization within the protein family despite structural conservation.

What are optimal expression systems for producing recombinant UPF0496 protein 1?

For recombinant production of UPF0496 protein 1, several expression systems have been evaluated, each with distinct advantages:

  • E. coli-based expression: Most commonly used for initial characterization due to high yields and straightforward protocols. The protein can be successfully expressed with an N-terminal His-tag in E. coli, typically yielding 5-10 mg/L of culture .

  • Plant-based expression systems: Rice itself can serve as an expression platform with advantages including native post-translational modifications and proper folding. As noted in comparative studies: "Application of plant expression systems in the production of recombinant proteins has several advantages, such as low maintenance cost, absence of human pathogens, and possession of complex post-translational glycosylation capabilities" .

  • Cell-free expression systems: Useful for rapid screening and when the protein might be toxic to host cells.

The choice of expression system should be guided by experimental requirements, particularly whether native post-translational modifications are essential for functional studies .

How can the purification protocol for recombinant UPF0496 protein 1 be optimized using Design of Experiments (DoE)?

Design of Experiments (DoE) provides a powerful approach for optimizing purification protocols for recombinant proteins like UPF0496 protein 1. Unlike the inefficient one-factor-at-a-time approach, DoE enables researchers to systematically evaluate multiple parameters simultaneously, identifying optimal conditions with fewer experiments .

A systematic DoE approach for UPF0496 protein 1 purification would include:

  • Factor identification: Key variables affecting purification typically include buffer pH (7.0-8.5), salt concentration (0-500 mM NaCl), imidazole concentration for elution (50-300 mM), and flow rate during chromatography.

  • Experimental design: Using software packages mentioned in literature, design a factorial experimental matrix (typically 16-24 experiments for 4-5 factors) .

  • Response measurement: Define clear metrics for success (yield, purity, activity) and measure consistently across experiments.

  • Analysis and modeling: Use statistical analysis to determine main effects and interactions between factors.

  • Verification: Confirm optimal conditions with validation experiments.

This approach has been demonstrated to reduce optimization time from weeks to days while improving final purification outcomes for related recombinant proteins .

What methods are recommended for verifying the identity and purity of recombinant UPF0496 protein 1?

A comprehensive validation strategy for recombinant UPF0496 protein 1 should employ multiple complementary techniques:

  • SDS-PAGE analysis: Verifies molecular weight and provides initial purity assessment. For UPF0496 protein 1, expected purity should exceed 90% as determined by densitometry analysis of protein bands .

  • Western blotting: Using antibodies against the protein or fusion tag (e.g., anti-His) confirms identity while providing enhanced sensitivity for detecting low-abundance contaminants or degradation products.

  • Mass spectrometry: For precise molecular weight determination and peptide mapping. MALDI-TOF or ESI-MS can confirm the intact mass, while LC-MS/MS peptide analysis provides sequence coverage verification.

  • Size exclusion chromatography: Assesses homogeneity and can detect aggregation states or oligomerization.

  • Dynamic light scattering: Evaluates size distribution and aggregation propensity in solution.

For research applications requiring the highest quality, combining at least three of these methods is recommended to ensure comprehensive characterization of the recombinant protein .

How should experiments be designed to investigate UPF0496 protein 1's role in drought response?

To investigate UPF0496 protein 1's potential role in drought response, a comprehensive experimental design should integrate molecular, genetic, and physiological approaches:

  • Expression profiling under drought conditions:

    • qRT-PCR analysis comparing UPF0496 protein 1 expression between control and drought-stressed plants at multiple timepoints

    • Western blot analysis to confirm translation of transcriptional changes

    • Comparison between drought-sensitive and drought-resistant cultivars

  • Genetic modification approaches:

    • Generate transgenic rice lines with altered UPF0496 protein 1 expression (overexpression and knockdown/knockout)

    • Use CRISPR/Cas9 for precise gene editing

    • Evaluate phenotypic responses to controlled drought conditions

  • QTL mapping and association studies:

    • Utilize recombinant inbred lines (RILs) for mapping, similar to approaches described in the literature: "In this study, the markers included in RM1-RM490 and ISSR2-3-RM133 of chromosomes 1 and 6 of Oryza sativa were identified as the main regulators of traits associated with Oryza sativa drought resistance"

    • Screen for association between UPF0496 protein 1 polymorphisms and drought tolerance traits

  • Physiological analyses:

    • Compare water use efficiency, osmotic adjustment, and ABA sensitivity between wild-type and modified lines

    • Measure key drought response parameters (stomatal conductance, leaf water potential, photosynthetic efficiency)

This multi-level approach enables connecting molecular mechanisms to whole-plant physiological responses, providing a comprehensive understanding of UPF0496 protein 1's role in drought adaptation .

What statistical approaches are most appropriate for analyzing UPF0496 protein expression data across different experimental conditions?

Statistical analysis of UPF0496 protein 1 expression data requires approaches tailored to the experimental design and data characteristics:

  • Descriptive statistics:

    • For initial data exploration, calculate means, standard deviations, and coefficients of variation

    • Assess data distribution (normality tests: Shapiro-Wilk, Kolmogorov-Smirnov)

    • As noted in methodological literature: "Measures of central tendency such as the mean, median, and mode summarize the performance level of a group of scores, and measures of variability describe the spread of scores"

  • Comparative statistics:

    • For two-group comparisons: independent t-test (parametric) or Mann-Whitney U test (non-parametric)

    • For multi-group comparisons: one-way ANOVA with appropriate post-hoc tests (Tukey's HSD for balanced designs, Games-Howell for unequal variances)

    • For factorial designs with multiple variables: two-way or three-way ANOVA

  • Multivariate approaches:

    • Principal Component Analysis (PCA) for identifying patterns across multiple expression datasets

    • Hierarchical clustering for grouping similar experimental conditions or genotypes

  • Statistical power considerations:

    • Sample size calculation based on expected effect size and variability

    • Adjustment for multiple testing (FDR, Bonferroni correction)

Sample data presentation format:

TreatmentMean Expression (ng/mg)Standard DeviationSample Sizep-value
Control14.3±1.76-
Mild Drought23.8±2.960.012*
Severe Drought31.2±3.46<0.001**
Recovery19.5±2.260.025*

*p<0.05, **p<0.01 compared to control

This approach ensures rigorous analysis while minimizing the risk of false positives/negatives in expression studies .

How can Design of Experiments (DoE) be applied to optimize conditions for UPF0496 protein 1 activity assays?

Design of Experiments (DoE) provides a systematic framework for optimizing UPF0496 protein 1 activity assays, enabling efficient identification of optimal conditions while elucidating factor interactions:

  • Factor identification and range selection:

    • Key factors typically include buffer pH (6.0-9.0), temperature (4-37°C), cofactor concentrations, substrate concentrations, and incubation time

    • Ranges should be determined from preliminary experiments or literature on related proteins

  • DoE methodology selection:

    • Screening designs: Plackett-Burman or fractional factorial designs to identify significant factors from many possibilities

    • Response surface methodology (RSM): For fine-tuning identified significant factors

    • As noted in literature: "DoE approaches with a carefully selected small set of experiments, and therefore with a reduced cost and in a limited amount of time predict the effect of each factor and the effects of their interactions on a process"

  • Experimental execution:

    • Randomize experimental order to minimize systematic bias

    • Include center points for detecting non-linear responses

    • Maintain consistent protein quality across experiments

  • Response analysis:

    • Apply appropriate statistical methods (ANOVA, regression)

    • Generate response surface plots to visualize factor interactions

    • Identify optimal conditions and factor sensitivities

A typical optimization matrix might look like:

ExperimentpHTemperature (°C)Substrate (mM)Cofactor (mM)Activity (units)
17.0251.02.0142
28.0251.05.0189
37.0301.05.0165
..................
168.0302.05.0227

This systematic approach has been demonstrated to reduce optimization time by up to 75% while identifying conditions that would be difficult to discover using traditional approaches .

What proteomic approaches can be used to study UPF0496 protein 1's interactions with other proteins?

A comprehensive proteomic investigation of UPF0496 protein 1 interactions requires multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged UPF0496 protein 1 (His, FLAG, or TAP tag) in rice cells

    • Isolate protein complexes under native conditions using affinity chromatography

    • Identify interacting partners via LC-MS/MS

    • Include appropriate controls (untagged bait, unrelated tagged protein)

  • Proximity-dependent biotin identification (BioID):

    • Generate fusion of UPF0496 protein 1 with a biotin ligase (BirA*)

    • Express in rice cells, allowing biotinylation of proximal proteins

    • Purify biotinylated proteins and identify via mass spectrometry

    • Particularly useful for detecting transient or weak interactions

  • Co-immunoprecipitation with targeted validation:

    • Use antibodies against native UPF0496 protein 1 or epitope tags

    • Confirm interactions with candidate proteins via Western blotting

    • Perform reciprocal co-IPs to verify specific interactions

  • Protein correlation profiling:

    • Fractionate cellular components using size exclusion chromatography

    • Analyze protein distribution across fractions using quantitative proteomics

    • Identify proteins with similar elution profiles as UPF0496 protein 1

This multi-faceted approach has proven effective for other rice proteins, as demonstrated in published research: "These analyses identified 5 novel proteins by de novo sequencing and revealed several important proteins, mainly involved in signal transduction, protein synthesis, assembly and degradation" .

How should researchers approach QTL mapping to identify genomic regions associated with UPF0496 protein 1 function?

Quantitative Trait Locus (QTL) mapping for UPF0496 protein 1-associated traits requires a structured approach combining genetic, molecular, and phenotypic analyses:

  • Population development:

    • Generate recombinant inbred lines (RILs) from crosses between parental lines showing phenotypic variation in traits of interest

    • Advance to F8 or later generations to achieve genetic homozygosity

    • Ensure adequate population size (typically 120-200 lines) for statistical power

  • Genotypic evaluation:

    • Employ molecular markers distributed across the genome, with emphasis on chromosome 3 where the UPF0496 protein 1 gene is located

    • Use a combination of marker types: "In this study, 90 SSR markers and 28 ISSR, 6 iPBS, and 9 IRAP markers (265 polymorphic alleles) were used to identify the chromosomal position and to investigate the polymorphism of the studied lines"

    • Construct a genetic linkage map with appropriate mapping software

  • Phenotypic analysis:

    • Evaluate traits potentially related to UPF0496 protein 1 function (e.g., stress tolerance, developmental characteristics)

    • Perform experiments under multiple environmental conditions to identify environment-specific QTLs

    • Measure traits with precision and appropriate replication

  • QTL analysis:

    • Apply appropriate statistical methods (interval mapping, composite interval mapping)

    • Calculate logarithm of odds (LOD) scores and identify significant QTLs

    • Determine phenotypic variance explained by each QTL

  • Candidate gene analysis:

    • Examine genes within identified QTL regions

    • Verify UPF0496 protein 1 expression in relevant tissues

    • Conduct fine mapping to narrow down candidate regions

This approach has successfully identified QTLs for various traits in rice, as evidenced by research showing: "The linkage map of the 90 SSR markers and the 28 ISSR, 6 iPBS and 9 IRAP markers (265 polymorphic alleles) on 120 individuals in the F8 population divided the markers into 12 linkage groups belonging to 12 chromosomes" .

What bioinformatic tools and pipelines are recommended for analyzing UPF0496 protein 1 sequence evolution and conservation?

A comprehensive bioinformatic analysis of UPF0496 protein 1 evolution requires an integrated pipeline of specialized tools:

  • Sequence retrieval and homolog identification:

    • Primary sequence acquisition from curated databases (UniProt, NCBI)

    • BLAST or PSI-BLAST searches against comprehensive databases

    • As noted in methodology literature: "The primary sequence of Ory s1 from Oryza sativa was acquired from the NCBI's GenPept, a publicly available database. BLAST (psi blast) search, using the non-redundant database, was performed that resulted homologous sequences"

  • Multiple sequence alignment:

    • Tools: MUSCLE, Clustal Omega, or MAFFT for alignment generation

    • Jalview or AliView for alignment visualization and editing

    • Identification of conserved regions and motifs

  • Phylogenetic analysis:

    • Model testing to identify optimal evolutionary models

    • Tree construction using maximum likelihood (RAxML, IQ-TREE) or Bayesian inference (MrBayes)

    • Bootstrap analysis (1000+ replicates) for branch support evaluation

  • Domain and motif analysis:

    • InterPro and Pfam for domain identification

    • MEME/MAST for de novo motif discovery: "Motif search in the multiple sequence alignment was carried out using Multiple Em for Motif Elicitation (MEME tool) technique"

    • Conservation scoring (ConSurf) to identify functionally important residues

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify sites under positive or purifying selection

    • PAML or HyPhy for sophisticated selection analyses

    • Sliding window analyses to identify regions with varying selection pressures

This integrated approach enables researchers to understand UPF0496 protein 1 evolutionary history, identify functionally important regions, and generate testable hypotheses about protein function based on evolutionary conservation patterns .

What strategies can address low expression or insolubility of recombinant UPF0496 protein 1?

When facing challenges with low expression or insolubility of recombinant UPF0496 protein 1, researchers should implement a systematic troubleshooting approach:

  • Expression optimization strategies:

    • Lower induction temperature (16-20°C) to slow folding and reduce aggregation

    • Reduce inducer concentration for gentler expression

    • Use rich media (TB or 2YT) instead of minimal media

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Test different E. coli strains (BL21, Rosetta for rare codons, Origami for disulfide formation)

  • Solubility enhancement techniques:

    • Fusion with solubility tags (MBP, SUMO, Trx, GST)

    • Buffer optimization (screening pH range 6.0-9.0, salt concentration 100-500 mM)

    • Addition of stabilizing additives (10% glycerol, 0.1-0.5M arginine, 1mM TCEP)

    • Similar proteins benefit from: "Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0"

  • Structural modifications:

    • Express individual domains separately

    • Remove flexible or hydrophobic regions predicted to cause aggregation

    • Introduce surface mutations to increase solubility

  • Refolding from inclusion bodies:

    • If soluble expression fails, isolate inclusion bodies

    • Solubilize in denaturing agents (8M urea or 6M guanidine)

    • Refold by dialysis against decreasing denaturant concentration

    • Include refolding additives (0.4M arginine, PEG, oxidized/reduced glutathione)

  • Design of Experiments approach:

    • Systematically evaluate multiple factors simultaneously

    • "DoE approaches with a carefully selected small set of experiments, and therefore with a reduced cost and in a limited amount of time predict the effect of each factor and the effects of their interactions on a process"

This structured approach has been demonstrated to increase soluble protein yields from <1 mg/L to >10 mg/L for challenging recombinant proteins .

How can researchers troubleshoot inconsistent results in UPF0496 protein 1 functional assays?

Inconsistent results in UPF0496 protein 1 functional assays require systematic troubleshooting at multiple levels:

When troubleshooting, organize findings in a structured format to identify patterns:

VariableTested RangeEffect on ConsistencyOptimal Condition
Temperature20-37°CHigh impact25±1°C
Buffer pH6.5-8.5Moderate impact7.5±0.1
Protein concentration0.1-1.0 mg/mLLow impact0.5 mg/mL
Incubation time10-60 minHigh impact30±2 min

This systematic approach can transform inconsistent assays into robust, reproducible protocols essential for reliable functional characterization .

How can UPF0496 protein 1 research contribute to understanding rice stress adaptation mechanisms?

UPF0496 protein 1 research offers significant potential for elucidating rice stress adaptation mechanisms through several integrated approaches:

  • Transcriptional and translational regulation:

    • Characterize UPF0496 protein 1 expression patterns across tissues and developmental stages

    • Examine expression modulation under various stresses (drought, salinity, temperature extremes)

    • Identify transcription factors regulating UPF0496 protein 1 expression

    • Correlate findings with whole-transcriptome data to identify co-regulated genes

  • Genetic diversity analysis:

    • Examine UPF0496 protein 1 sequence variation across rice cultivars with different stress tolerances

    • Map natural variation to stress resistance phenotypes

    • Similar approaches have identified drought resistance loci: "In this study, the markers included in RM1-RM490 and ISSR2-3-RM133 of chromosomes 1 and 6 of Oryza sativa were identified as the main regulators of traits associated with Oryza sativa drought resistance"

  • Functional characterization through genetic modification:

    • Generate knockout/knockdown lines using CRISPR/Cas9 or RNAi

    • Create overexpression lines using constitutive or stress-inducible promoters

    • Assess phenotypic responses to multiple stresses

    • Perform detailed physiological analyses (water use efficiency, photosynthetic parameters, hormone levels)

  • Protein interaction network analysis:

    • Identify UPF0496 protein 1 interaction partners under normal and stress conditions

    • Map these interactions to known stress response pathways

    • Proteomic approaches have been effective in rice: "Functional classification reveals that an overrepresentation of the proteins was related to signal transduction (10%), wall remodeling and metabolism (11%), and protein synthesis, assembly and degradation (14%)"

This multi-level approach can position UPF0496 protein 1 within the broader context of rice stress adaptation networks, potentially revealing novel components of stress signaling pathways applicable to crop improvement .

What methodological advances are needed to better understand the biochemical functions of UPF0496 proteins?

To advance our understanding of UPF0496 proteins' biochemical functions, several methodological innovations and approaches are needed:

  • Structural biology applications:

    • High-resolution 3D structure determination via X-ray crystallography or cryo-EM

    • NMR spectroscopy for dynamics and ligand binding studies

    • Computational modeling integrated with experimental validation

    • Identification of functionally important residues through structure-guided mutagenesis

  • Advanced protein-protein interaction methodologies:

    • Development of UPF0496-specific antibodies for endogenous interaction studies

    • Application of proximity labeling techniques (BioID, APEX) in native plant contexts

    • Single-molecule techniques to examine interaction dynamics

    • Protein microarrays for high-throughput interaction screening

  • Functional genomics at scale:

    • CRISPR screens targeting multiple domains of UPF0496 proteins

    • Tissue-specific and inducible gene regulation systems

    • High-throughput phenotyping platforms for subtle phenotypic changes

    • Integration of multi-omics data (transcriptomics, proteomics, metabolomics)

  • In vitro biochemical characterization:

    • Development of activity assays based on predicted functions

    • Substrate screening methods for enzymatic function identification

    • Ligand binding assays for receptor or transporter functions

    • Post-translational modification mapping and functional assessment

  • Plant-specific experimental systems:

    • Refinement of transformation and gene editing in rice

    • Development of rice cell lines for high-throughput assays

    • Protoplast systems for transient expression studies

    • Improved methods for studying proteins at native expression levels

These methodological advances would address current limitations in understanding UPF0496 proteins, as highlighted by research noting that "11% of the identified proteins are functionally unknown and do not contain any conserved domain associated with known activities" , providing a pathway to characterize this important but understudied protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.