Recombinant Oryza sativa subsp. japonica UPF0496 protein 4 (Os10g0513300, LOC_Os10g36950)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Oryza sativa subsp. japonica UPF0496 protein 4 (Os10g0513300, LOC_Os10g36950) is a protein derived from rice (Oryza sativa subsp. japonica) and belongs to the UPF0496 protein family . The terms Os10g0513300 and LOC_Os10g36950 are identifiers for this protein within the rice genome .

Basic Characteristics

CharacteristicDescription
Full NameRecombinant Full Length Oryza Sativa Subsp. Japonica Upf0496 Protein 4(Os10G0513300, Loc_Os10G36950)
Source (Host)E. coli
SpeciesRice (Oryza sativa)
TagHis-Tagged
Protein LengthFull Length (1-456)
Molecular Weight49,737 Da
AA SequenceMSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLT
LSLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSR
LDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCARLVSCSATLQELAG
NLSLMKVKNSAKGKVLMRALYGIESVTVFVCSIFVAVLSGSPKPLVELHVPEKFGWSQAF
NDLHTAVSEELTRQLSGGSVAAVKELEEVEACARRLHVLASTSQLEEEAANLANAVSHTE
EEVMSDSIAQEGDHHCGLKLADDTTREGGIVISESIAEGGTQEAEMKKDISYEKEVAMVE
RISYKEHQDSNVKQANGSSDESALVVPERTSVQESKEELLNCISSMSKSAEGLRHGLDSL
SKRVGDFFQIVLTGRDALLCNLRISDAASKVAEVSS
UniProt Accession #U496D_ORYSJ

Function

The specific biochemical functions of Os10g0513300 are not explicitly detailed, but it is known to participate in several pathways and interact with various proteins and molecules . Further information may be available from Creative BioMart .

Expression

The protein's expression region spans from amino acids 1 to 456, indicating it is a full-length protein .

Availability

Recombinant forms of this protein are available for research purposes from commercial suppliers such as Creative BioMart and CD BioSciences . These recombinant proteins are expressed in hosts like E. coli and are often tagged with His for purification and detection .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os10g0513300; LOC_Os10g36950; OsJ_030878; OSJNBa0026L12.27; UPF0496 protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os10g0513300
Target Protein Sequence
MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLT LSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSR LDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCARLVSCSATLQELAG NLSLMKVKNSAKGKVLMRALYGIESVTVFVCSIFVAVLSGSPKPLVELHVPEKFGWSQAF NDLHTAVSEELTRQLSGGSVAAVKELEEVEACARRLHVLASTSQLEEEAANLANAVSHTE EEVMSDSIAQEGDHHCGLKLADDTTREGGIVISESIAEGGTQEAEMKKDISYEKEVAMVE RISYKEHQDSNVKQANGSSDESALVVPERTSVQESKEELLNCISSMSKSAEGLRHGLDSL SKRVGDFFQIVLTGRDALLCNLRISDAASKVAEVSS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0496 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UPF0496 protein 4 from Oryza sativa subsp. japonica?

UPF0496 protein 4 from Oryza sativa subsp. japonica is a member of the uncharacterized protein family 0496 found in rice (Oryza sativa subspecies japonica). The protein is encoded by the Os10g0513300 gene (also referenced as LOC_Os10g36950 in some databases) located on chromosome 10 of the rice genome. UPF designations (Uncharacterized Protein Family) are assigned to protein families with unknown functions that have been identified through genomic or transcriptomic analyses but lack defined biological roles. While similar in some aspects to the UPF0496 protein 2 identified in Oryza sativa subsp. indica, the japonica subspecies variant may exhibit subspecies-specific structural features and functions. Researchers typically investigate these proteins to elucidate their native functions in rice biology, potentially uncovering novel biochemical pathways or regulatory mechanisms that could be exploited for agricultural improvement or biotechnological applications.

What expression systems are suitable for producing recombinant Oryza sativa UPF0496 proteins?

Several expression systems have demonstrated effectiveness for producing recombinant proteins from rice, with the selection dependent on research objectives and required protein characteristics. Bacterial systems such as Escherichia coli offer rapid production cycles and high yields but may present challenges with proper folding and disulfide bond formation in complex eukaryotic proteins . Yeast-based systems including Saccharomyces cerevisiae and Pichia pastoris represent middle-ground options that combine prokaryotic growth rates with eukaryotic post-translational processing capabilities, though glycosylation patterns differ from plant-native forms . Plant-based expression systems, particularly rice cell cultures or transgenic rice seeds, often provide the most authentic post-translational modifications and proper folding environment for rice proteins . The rice endosperm expression system has proven remarkably effective for recombinant protein production, with some proteins achieving expression levels of up to 10-11% of total soluble protein . For structural studies requiring non-glycosylated variants, bacterial or certain yeast systems with optimized codons may be preferable despite potential folding challenges.

What purification strategies are most effective for rice-derived recombinant proteins?

Purification of rice-derived recombinant proteins typically employs a multi-step approach that balances yield, purity, and preservation of native structure and function. For tagged recombinant proteins such as His-tagged constructs (similar to the approach used for Oryza sativa subsp. indica UPF0496 protein 2), immobilized metal affinity chromatography (IMAC) provides an efficient initial capture step . This can be followed by additional chromatographic techniques including ion exchange, hydrophobic interaction, or size exclusion chromatography to achieve higher purity levels . For large-scale purification of recombinant proteins from rice seeds, specialized protocols have been developed that can achieve recovery rates exceeding 2.75 g/kg of brown rice for certain proteins, making the approach economically viable for research and potentially commercial applications . Researchers should consider incorporating protease inhibitors during extraction to minimize degradation, and optimizing buffer conditions (pH, ionic strength, reducing agents) based on the specific physicochemical properties of UPF0496 proteins. Purification protocols may need modification to address rice-specific contaminants such as phytic acid, phenolic compounds, and storage proteins that can interfere with purification processes.

How are structural characteristics of rice UPF0496 proteins typically determined?

Structural characterization of rice UPF0496 proteins employs a complementary suite of analytical techniques to elucidate primary through quaternary structural features. Primary sequence confirmation typically involves mass spectrometry-based approaches, including peptide mapping through tryptic digestion and LC-MS/MS analysis, which can verify sequence integrity and identify potential post-translational modifications . Secondary and tertiary structural elements are commonly assessed using circular dichroism (CD) spectroscopy to determine alpha-helical and beta-sheet content, while thermal stability can be evaluated through differential scanning calorimetry or thermal shift assays. Higher-resolution structural analysis often employs X-ray crystallography, which has successfully been used to determine the structures of various rice-derived recombinant proteins with resolution allowing detailed examination of structural motifs, disulfide bond arrangements, and potential ligand binding sites . Nuclear magnetic resonance (NMR) spectroscopy provides an alternative approach particularly valuable for examining solution-state dynamics and ligand interactions. Computational approaches using homology modeling can supplement experimental data, especially for preliminary structural insights when crystallographic data is unavailable.

What experimental challenges are commonly encountered when working with recombinant UPF0496 proteins?

Researchers working with recombinant UPF0496 proteins from rice often encounter several significant experimental challenges requiring specialized approaches. Protein solubility issues represent a primary concern, as these uncharacterized proteins may fold improperly or aggregate during expression or purification procedures . This necessitates extensive optimization of expression conditions including temperature modulation, codon optimization, and fusion with solubility-enhancing tags. Another common difficulty involves establishing protein function in the absence of characterized homologs or identified binding partners, requiring unbiased screening approaches such as protein-protein interaction studies, metabolite binding assays, or activity-based protein profiling. Post-translational modifications present in native rice proteins may be absent or altered in recombinant systems, potentially affecting structure and function; researchers must therefore carefully select expression systems based on their capacity to reproduce native modifications or deliberately produce non-modified variants for specific analyses . Additionally, crystallization for structural studies often proves challenging due to conformational flexibility or heterogeneity, requiring extensive screening of crystallization conditions and potentially protein engineering to enhance crystallizability. Functional redundancy within the UPF0496 family may also complicate phenotypic analysis in knockout or overexpression studies.

How do UPF0496 proteins from different Oryza sativa subspecies compare structurally and functionally?

Comparative analysis of UPF0496 proteins from different Oryza sativa subspecies reveals both conserved elements and subspecies-specific variations that may reflect adaptive functional divergence. Primary sequence alignment typically shows high conservation in functional domains and catalytic residues when present, while variations often cluster in regulatory regions or surface-exposed loops that may mediate subspecies-specific protein-protein interactions. Structural comparison through homology modeling or experimental structure determination can reveal differences in surface charge distribution, hydrophobic patches, or binding pocket architecture that may influence substrate specificity or binding partner selection. The UPF0496 protein 2 from Oryza sativa subsp. indica (OsI_023618) has a characterized amino acid sequence of 408 residues with specific motifs that may serve as reference points for comparative analysis with the japonica subspecies protein 4 . Functional differences between subspecies variants can be assessed through complementation assays, where the ability of one subspecies variant to rescue phenotypes in another subspecies provides insights into functional conservation. Patterns of evolutionary selection pressure across different domains of UPF0496 proteins can be quantified through calculation of nonsynonymous to synonymous substitution ratios (dN/dS), potentially identifying regions under positive selection that might contribute to subspecies-specific adaptation.

What approaches are most effective for determining the biological function of uncharacterized UPF0496 proteins?

Elucidating the biological function of uncharacterized UPF0496 proteins requires a multi-faceted approach combining computational prediction with experimental validation. Computational strategies typically begin with sensitive sequence-based homology searches using PSI-BLAST or HHpred to identify distant relatives with known functions, followed by structural prediction using AlphaFold2 or similar tools to identify potential functional sites based on structural conservation. Gene co-expression network analysis can identify genes consistently co-regulated with the UPF0496 target, providing functional context through guilt-by-association principles. Experimental approaches should include subcellular localization studies using fluorescent protein fusions to determine the cellular compartments where the protein functions, providing initial functional clues . CRISPR-Cas9 mediated gene knockout or RNAi-based knockdown studies in rice can reveal phenotypic consequences of UPF0496 protein deficiency, though functional redundancy may necessitate multiple gene targeting. Protein interaction studies using techniques such as affinity purification-mass spectrometry, yeast two-hybrid screening, or proximity labeling approaches can identify binding partners that may suggest functional pathways. Metabolomic profiling of knockout/knockdown lines compared to wild-type can reveal altered metabolite profiles indicative of specific biochemical pathways affected by the protein's absence.

What are the most reliable methods for assessing rice recombinant protein quality and authenticity?

Comprehensive quality assessment of recombinant rice proteins requires analytical techniques that evaluate multiple attributes including purity, integrity, conformation, and biological activity. Purity analysis typically employs a combination of SDS-PAGE with densitometry, high-performance liquid chromatography (HPLC), and capillary electrophoresis to quantify product-related and process-related impurities . Primary sequence verification through peptide mapping and mass spectrometry is essential for confirming complete and accurate translation, while mass spectrometric techniques can additionally identify and quantify potential post-translational modifications . Conformational integrity assessment employs spectroscopic methods including circular dichroism and fluorescence spectroscopy to confirm proper folding, while thermal shift assays provide insights into stability. For proteins with known or predicted activities, function-specific bioassays provide the most relevant measure of biological authenticity. The gold standard for three-dimensional structural verification is X-ray crystallography, which has been successfully applied to rice-derived recombinant proteins to demonstrate structural equivalence with native counterparts . Immunological methods using conformation-specific antibodies can provide additional evidence of proper folding and epitope presentation. For proteins intended for research applications, lot-to-lot consistency testing using a combination of these methods ensures reproducible experimental results.

What expression vector design considerations are important for optimal production of UPF0496 proteins in various systems?

Expression vector design for UPF0496 protein production requires careful consideration of multiple elements to optimize expression, purification, and functional studies. Promoter selection should be tailored to the expression system, with strong constitutive promoters like T7 for bacterial systems, AOX1 for Pichia pastoris, or glutelin/globulin promoters for rice seed expression providing high yield potential . Codon optimization based on the expression host's codon usage bias significantly impacts translation efficiency, with distinct optimization strategies required for bacterial, yeast, or plant expression systems. Fusion tag selection balances purification utility against potential interference with structure or function; while polyhistidine tags offer straightforward purification via immobilized metal affinity chromatography, their placement (N- or C-terminal) should consider potential impacts on protein folding . Incorporation of protease cleavage sites between the target protein and fusion tags allows tag removal when needed for functional or structural studies. Signal peptide inclusion directs proteins to specific subcellular compartments, which may impact folding, modification, and yield; for rice seed expression, signal peptides targeting the endoplasmic reticulum or protein storage vacuoles have proven effective for protein accumulation . Selection marker genes must be appropriate for the host system, while vector backbone elements should ensure stability in the expression host while facilitating molecular cloning workflows.

How can isotope labeling be effectively incorporated into recombinant rice proteins for NMR studies?

Isotope labeling of recombinant rice proteins for NMR studies requires strategic selection of expression systems and careful optimization of growth conditions to achieve sufficient incorporation while maintaining protein yield and structural integrity. While prokaryotic expression systems like E. coli offer the most straightforward approach for uniform 15N and 13C labeling using defined minimal media with isotope-enriched nitrogen and carbon sources, these systems may present folding challenges for rice proteins . Eukaryotic systems including yeast and insect cells provide intermediate options with better folding capabilities but higher isotope costs due to media complexity. Selective labeling approaches, particularly methyl group labeling of isoleucine, leucine, and valine residues, can reduce spectrum complexity while enabling studies of larger proteins beyond conventional size limits for NMR. For specific structural questions, amino acid-selective labeling can be employed by supplementing expression media with isotope-labeled amino acids of interest. Deuteration strategies, either uniform or fractional, combined with selective protonation of methyl groups, significantly improve spectral quality for larger proteins by reducing dipolar relaxation effects. Post-translational back-exchange of amide protons in deuterated proteins enhances detection of backbone resonances. Sequential assignment strategies must be adapted to the labeling approach, potentially requiring specialized pulse sequences for sparsely labeled proteins.

What crystallization strategies have proven successful for structural determination of rice-derived proteins?

Crystallization of rice-derived proteins for structural determination requires systematic exploration of crystallization conditions and often protein engineering to enhance crystallizability. Initial screening typically employs sparse matrix approaches covering diverse precipitation agents, buffers, and additives, with commercial screens supplemented by conditions previously successful for related proteins . Surface entropy reduction through mutation of surface-exposed flexible residues (particularly lysine and glutamate clusters) to alanine can significantly enhance crystallization propensity by creating favorable crystal contacts. Terminal truncation based on limited proteolysis or bioinformatic prediction of flexible regions often improves crystallization success by removing disordered segments that hinder lattice formation. Incorporation of fusion partners such as T4 lysozyme or BRIL can provide additional crystal contacts while stabilizing flexible regions. Ligand co-crystallization, whether with natural substrates, product analogs, or inhibitors, often stabilizes protein conformation and enhances crystal quality, as demonstrated in studies with rice-derived recombinant proteins binding fatty acids and other ligands . Post-crystallization optimization through techniques including seeding, dehydration, and annealing has proven effective for improving diffraction quality. Alternative crystallization methods including lipidic cubic phase for membrane-associated proteins or microfluidic approaches for proteins available in limited quantities provide additional options when conventional vapor diffusion methods prove insufficient.

What are the optimal conditions for long-term storage of purified UPF0496 proteins to maintain stability and activity?

Long-term storage of purified UPF0496 proteins requires conditions that minimize degradation, aggregation, oxidation, and conformational changes while maintaining functional integrity. Buffer composition represents a critical factor, with optimal pH typically within 1-2 units of the protein's isoelectric point to minimize charge-driven aggregation, though specific requirements may vary based on the protein's unique properties . Addition of stabilizing excipients including disaccharides (trehalose, sucrose) at 5-10% concentration can provide protection through preferential hydration mechanisms, with trehalose showing particular effectiveness for rice-derived proteins . Cryoprotectants such as glycerol (typically 10-50%) prevent ice crystal formation during freezing, with optimized concentration balancing cryoprotection against potential destabilizing effects at higher concentrations . Storage temperature selection balances degradation kinetics against freeze-thaw damage, with lyophilized formulations stable at higher temperatures while solution formulations typically require -20°C to -80°C storage . Aliquoting prevents repeated freeze-thaw cycles that promote aggregation and denaturation. Oxygen-free environments through container purging with nitrogen or addition of reducing agents (DTT, β-mercaptoethanol) minimize oxidative damage to sensitive residues. Stability assessment through accelerated aging studies at elevated temperatures coupled with activity and structural analysis provides predictive insights into long-term storage behavior under various conditions.

How should researchers interpret mass spectrometry data for post-translational modifications in rice-derived recombinant proteins?

Interpretation of mass spectrometry data for post-translational modifications (PTMs) in rice-derived recombinant proteins requires rigorous analytical approaches to distinguish genuine biological modifications from artifacts. Database search strategies should incorporate expected rice-specific modifications including hydroxylation, glycosylation, phosphorylation, and acetylation, while also accounting for system-specific artifacts that may occur during expression and purification . Mass accuracy thresholds should be set appropriately based on the instrument capabilities, with higher-resolution instruments enabling more confident PTM assignments. Fragment ion coverage represents a critical factor in PTM localization, with electron transfer dissociation (ETD) or electron capture dissociation (ECD) providing advantages for labile modifications compared to collision-induced dissociation (CID). Retention time analysis can provide additional confirmation for PTM assignments, as modified peptides typically exhibit characteristic shifts in chromatographic behavior. Validation of identified PTMs should employ multiple approaches including immunoblotting with modification-specific antibodies, chemical or enzymatic treatments that selectively remove specific modifications, or targeted experiments with isotopically labeled standard peptides. Biological significance assessment requires comparison of modification patterns between recombinant and native proteins when possible, potentially identifying differences attributable to the expression system that might impact structure or function . Quantitative analysis of modification stoichiometry provides insights into the homogeneity of the recombinant protein preparation and may identify substoichiometric modifications of potential regulatory significance.

How can researchers distinguish between experimental artifacts and genuine structural features in crystallographic data for UPF0496 proteins?

Distinguishing between experimental artifacts and genuine structural features in crystallographic data for UPF0496 proteins requires critical evaluation throughout the structure determination process. Data quality assessment begins with diffraction statistics including resolution limits, completeness, redundancy, and signal-to-noise ratios, which establish confidence boundaries for subsequent interpretation . Electron density map evaluation represents the primary means of validating structural features, with genuine features displaying continuous, well-defined density at appropriate contour levels while artifacts typically present as discontinuous or poorly defined regions. Model validation metrics including Ramachandran statistics, rotamer distributions, and geometric parameters (bond lengths, angles) provide quantitative measures of model quality, with outliers potentially indicating forced fitting to accommodate artifacts. B-factor analysis can distinguish ordered regions with reliable structural information from flexible regions where interpretation should be more cautious. Structural comparison with homologous proteins can highlight conserved features likely to be genuine versus unique features requiring stronger supporting evidence. Crystallographic artifacts can arise from crystal packing interactions constraining protein conformation, and these should be identified through analysis of crystal contacts and comparison of structures from different crystal forms when available . Alternative models should be tested against electron density when ambiguity exists, selecting the most parsimonious model consistent with the experimental data. Independent structure validation using complementary techniques such as NMR, SAXS, or cross-linking mass spectrometry provides additional confidence in the crystallographic model.

What computational tools are most effective for predicting potential binding partners and interaction sites for UPF0496 proteins?

Computational prediction of binding partners and interaction sites for UPF0496 proteins employs diverse approaches leveraging sequence, structure, and evolutionary information. Sequence-based methods for interaction site prediction include conservation analysis across orthologs, which can identify evolutionarily constrained surface residues likely involved in functionally important interactions. Structure-based approaches including molecular docking with candidate partners identified through co-expression or phenotypic similarity can predict binding modes and energetics, though results require experimental validation. Machine learning methods integrating multiple features (sequence conservation, physicochemical properties, structural context) achieve higher accuracy than single-feature approaches, with recent deep learning implementations showing particular promise. Protein-protein interaction network analysis using databases such as STRING or BioGRID combined with guilt-by-association principles can identify candidate interactors based on shared functional annotations or pathway membership. Coevolutionary analysis methods including direct coupling analysis (DCA) can identify residue pairs under coordinated evolutionary pressure, potentially indicating direct physical interactions within protein complexes. Structural modeling using AlphaFold-Multimer or similar tools provides increasingly accurate predictions of protein complex structures based on sequence information alone. Template-based modeling leveraging structures of homologous complexes offers another approach when structural templates are available. Functional site prediction tools including CASTp, POCASA, and FTSite can identify potential binding pockets based on geometric and energetic properties of the protein surface. Integration of predictions from multiple computational approaches increases confidence in identified interaction sites.

How do expression levels of UPF0496 proteins in different rice tissues correlate with potential biological functions?

Expression patterns of UPF0496 proteins across different rice tissues provide valuable insights into their potential biological functions within the plant. Tissue-specific expression profiling through RNA-seq or proteomics approaches typically reveals distinct expression patterns that correlate with developmental stages or environmental responses. UPF0496 proteins highly expressed in photosynthetic tissues may participate in light harvesting, photoprotection, or carbon fixation pathways, while those preferentially expressed in reproductive tissues could function in pollen development, fertilization, or seed formation. Stress-responsive expression patterns, wherein protein levels change significantly in response to drought, salt, pathogen exposure, or temperature extremes, suggest potential roles in stress adaptation mechanisms. Temporal expression analysis across developmental stages can distinguish constitutively expressed UPF0496 proteins likely involved in core cellular processes from those with stage-specific expression suggesting specialized developmental functions. Subcellular localization information combined with expression data provides additional functional context; for instance, proteins localized to chloroplasts and upregulated under high light conditions may participate in photoprotection mechanisms. Comparative expression analysis between subspecies can identify differentially regulated UPF0496 proteins that might contribute to subspecies-specific traits. Integration of expression data with phenotypic information from mutant studies particularly enhances functional hypotheses by connecting expression patterns to observable physiological outcomes.

What potential biotechnological applications exist for recombinant UPF0496 proteins from rice?

Recombinant UPF0496 proteins from rice present diverse biotechnological opportunities spanning agricultural, industrial, and biomedical applications. In agricultural biotechnology, genetic modification to optimize UPF0496 protein expression levels could enhance stress tolerance or nutrient utilization efficiency if these proteins participate in relevant biological pathways. Industrial enzyme applications may emerge if UPF0496 proteins demonstrate useful catalytic activities such as carbohydrate modification, particularly given the thermal and pH stability often observed in plant-derived enzymes. Rice-based recombinant protein production systems have demonstrated exceptional cost-effectiveness, with production rates of 2.75 g/kg brown rice for certain proteins far exceeding the cost-effective threshold of 0.1 g/kg . Biomedical applications could develop if UPF0496 proteins demonstrate bioactivities relevant to human health, such as antioxidant, anti-inflammatory, or immunomodulatory properties. Research reagent applications represent a near-term opportunity, with well-characterized recombinant UPF0496 proteins serving as standards for antibody validation or as tools for studying rice biochemistry and physiology. Rice-derived recombinant proteins have demonstrated structural and functional equivalence to their native counterparts, suggesting that the expression system preserves critical protein characteristics . Bioremediation applications could emerge if UPF0496 proteins bind heavy metals or other environmental contaminants. The cost-effective nature of rice seed bioreactors makes them particularly attractive for large-scale production of industrial enzymes or biopharmaceuticals .

How can structural information about UPF0496 proteins inform protein engineering strategies?

Structural information about UPF0496 proteins provides foundational knowledge for rational protein engineering strategies aimed at enhancing stability, altering specificity, or introducing novel functions. Domain architecture analysis identifies structurally and functionally distinct regions that can be individually modified or recombined with domains from other proteins to create chimeras with novel properties. Active site or binding pocket engineering based on detailed structural information can modify substrate specificity or catalytic efficiency through targeted mutations that alter the electrostatic environment, hydrophobicity, or steric constraints of functional sites. Stability engineering strategies leverage structural insights to introduce stabilizing interactions including disulfide bonds at positions identified through computational analysis of the protein structure, potentially enhancing tolerance to temperature extremes or organic solvents. Surface modification through mutation of exposed residues can alter solubility, reduce aggregation propensity, or introduce novel interaction capabilities without disrupting core structural elements. Protein dynamics information from NMR studies or molecular dynamics simulations can identify flexible regions that might benefit from rigidification to enhance stability or regions where increased flexibility might improve function. Computational design tools including Rosetta and FoldX, when applied using accurate structural models as starting points, enable in silico screening of thousands of potential mutations to identify promising candidates for experimental validation. De novo design approaches creating novel binding sites or catalytic centers within the UPF0496 scaffold represent advanced applications of structural knowledge for protein engineering.

What emerging technologies will accelerate characterization of UPF0496 protein structure and function in the next decade?

Emerging technologies across computational, structural, and functional domains promise to revolutionize UPF0496 protein characterization in the coming decade. AI-driven structure prediction, exemplified by AlphaFold2 and RoseTTAFold, has dramatically accelerated protein structure determination, with accuracy approaching experimental methods for many protein classes; these tools will likely evolve to better predict protein dynamics, interactions, and effects of post-translational modifications. Cryo-electron microscopy advancements including improved detectors, phase plates, and computational image processing continue to push resolution boundaries while requiring smaller sample quantities than traditional structural methods, potentially enabling structural determination of UPF0496 proteins previously resistant to crystallization . Integrative structural biology approaches combining multiple experimental data types (X-ray crystallography, NMR, cryo-EM, SAXS, crosslinking mass spectrometry) with computational modeling will provide more complete structural understanding, particularly for dynamic regions and complexes. Single-molecule techniques including FRET and force spectroscopy offer unprecedented insights into protein dynamics and conformational changes that may be critical to UPF0496 protein function. High-throughput functional screening using microfluidic platforms coupled with next-generation sequencing enables massively parallel assessment of protein variants, accelerating both functional characterization and protein engineering. Mass spectrometry advancements including native MS, hydrogen-deuterium exchange, and ion mobility provide new dimensions of structural and functional information. Gene editing technologies including base editors and prime editors enable precise manipulation of UPF0496 genes in their native genomic context, facilitating in vivo functional studies with minimal off-target effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.