Recombinant Oryza sativa subsp. japonica UPF0603 protein Os05g0401100, chloroplastic (Os05g0401100, LOC_Os05g33280)

Shipped with Ice Packs
In Stock

Description

Overview and Nomenclature

The recombinant UPF0603 protein Os05g0401100 (UniProt ID: Q6ATY4) is a chloroplast-localized protein expressed in Oryza sativa subsp. japonica (rice). It belongs to the UPF0603 family, characterized as uncharacterized proteins of unknown function . Key identifiers include:

AttributeValue
Gene NameOs05g0401100, LOC_Os05g33280
SynonymsOSJNBa0035J16.9
Protein Length99–299 amino acids (mature form)
Molecular Weight~31.8 kDa
SourceE. coli (recombinant expression)
TagN-terminal His-tag

This protein is often referred to by its locus tags, which are critical for genomic and proteomic studies .

Biological Function and Localization

While the exact cellular role remains uncharacterized, bioinformatics and localization studies suggest:

  • Chloroplast Localization: The protein is predicted to reside in the thylakoid lumen, based on sequence homology and functional annotation .

  • Potential Roles:

    • Protein Quality Control: UPF0603 homologs may interact with proteases (e.g., Deg1 complex) involved in chloroplast protein degradation .

    • Stress Response: Chloroplast-localized proteins often participate in ROS detoxification or stress adaptation .

Genomic Context

Gene IDSpeciesHomologs
Os05g0401100O. sativaLOC_Os05g33280
LOC4338729O. sativaQ6ATY4 (UniProt)

Comparative genomics indicate conserved gene structure across rice subspecies, though functional divergence may exist .

Research Applications

Recombinant UPF0603 protein is utilized in:

Diagnostics

  • ELISA Standards: Serves as an antigen in immunoassays to detect specific antibodies or validate diagnostic kits .

  • Protein Interactions: Used in pull-down assays to study binding partners (e.g., chloroplast chaperones) .

Functional Assays

  • Protease Activity: Assessed in combination with Deg proteases to study chloroplast protein turnover .

Production and Quality Control

Critical parameters for recombinant production:

ParameterDetails
HostE. coli (BL21(DE3) strain)
InductionIPTG (0.1–1.0 mM)
PurificationNickel-nitrilotriacetic acid (Ni-NTA)
Quality AssuranceSDS-PAGE, Western blot, MS analysis

Protein batches are verified for purity (>90%) and activity (e.g., binding assays) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os05g0401100; LOC_Os05g33280; OSJNBa0035J16.9; UPF0603 protein Os05g0401100, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
99-299
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os05g0401100
Target Protein Sequence
SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADA FEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVG GLLVIAFVVPMAQYYAYISKK
Uniprot No.

Target Background

Database Links

KEGG: osa:4338729

STRING: 39947.LOC_Os05g33280.1

UniGene: Os.5229

Protein Families
UPF0603 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Lumenal side.

Q&A

What is UPF0603 protein Os05g0401100 and what is its significance in rice biology?

UPF0603 protein Os05g0401100 (LOC_Os05g33280) is a chloroplast-targeted protein in rice (Oryza sativa subsp. japonica). This protein belongs to the UPF0603 family, which includes functionally uncharacterized proteins that localize to the chloroplast. Based on comparative studies with other chloroplastic proteins, UPF0603 proteins likely play important roles in chloroplast development and function .

The significance of this protein stems from its chloroplastic localization, as chloroplast development is essential for rice growth, photosynthesis, and ultimately yield. Studies on chloroplast-targeted proteins have shown that disruptions in chloroplast protein function often lead to phenotypes including albinism, reduced chlorophyll content, and compromised photosynthetic capacity . Understanding UPF0603 protein function may provide insights into optimizing rice productivity and stress resistance.

What expression systems are commonly used for producing recombinant UPF0603 protein?

For recombinant production of rice UPF0603 protein, E. coli expression systems are most commonly employed. The protocol typically involves:

  • Gene cloning: The mature protein coding sequence (amino acids 99-299) is cloned into an expression vector with an N-terminal His-tag for purification .

  • Expression conditions: Transformation into E. coli followed by induction of protein expression under optimized conditions (temperature, IPTG concentration, duration) .

  • Purification: Affinity chromatography using the His-tag, yielding protein with >90% purity as determined by SDS-PAGE .

  • Storage: Lyophilization of purified protein and storage at -20°C/-80°C. For working solutions, reconstitution in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol is recommended to maintain stability .

When designing experiments with recombinant UPF0603 protein, researchers should consider that bacterial expression might lack plant-specific post-translational modifications, potentially affecting protein function compared to native rice protein.

What methods can be used to verify the chloroplastic localization of UPF0603 protein?

Verification of UPF0603 protein chloroplastic localization can be accomplished through multiple complementary approaches:

  • Bioinformatic prediction tools:

    • Programs like TargetP, ChloroP, and LOCALIZER can predict subcellular localization based on transit peptide sequences.

    • UPF0603 proteins contain characteristic chloroplast transit peptides (first ~98 amino acids) .

  • Fluorescent protein fusion visualization:

    • Construction of GFP/YFP fusion proteins with UPF0603.

    • Transient expression in rice protoplasts or stable transformation in rice plants.

    • Visualization using confocal microscopy and co-localization with chloroplast markers .

  • Subcellular fractionation and Western blotting:

    • Isolation of chloroplasts from rice leaves using Percoll gradient centrifugation.

    • Protein extraction from isolated chloroplasts.

    • Western blot analysis using specific antibodies against UPF0603 protein.

    • Verification with chloroplast marker proteins (e.g., RbcL) and absence of cytosolic markers .

  • Proteomic analysis of isolated chloroplasts:

    • LC-MS/MS analysis of purified chloroplast fractions.

    • Identification of UPF0603 protein in chloroplast proteome .

Researchers have successfully used these methods to confirm the chloroplastic localization of various proteins in rice, including those involved in chloroplast development and photosynthesis .

How can CRISPR/Cas9 genome editing be optimized for functional analysis of UPF0603 protein Os05g0401100?

CRISPR/Cas9 genome editing offers powerful approaches for functional analysis of UPF0603 protein Os05g0401100. Based on successful CRISPR applications in rice, the following strategy is recommended:

  • sgRNA design optimization:

    • Target multiple sites within the Os05g0401100 gene to increase knockout efficiency.

    • Design sgRNAs with minimal off-target effects using rice genome-specific prediction tools.

    • For UPF0603 protein, designing sgRNAs targeting both 5' and coding regions can provide knockout and knockdown variants for comparative analysis .

  • Vector construction strategy:

    • Construct expression vectors containing Cas9 under the rice-specific Ubiquitin promoter (pYLCRISPR/Cas9Pubi-H).

    • Include multiple sgRNAs in a single vector using overlapping PCR techniques.

    • Verify assembled vectors through bacterial PCR amplification and sequencing prior to transformation .

  • Transformation and screening protocol:

    • Use Agrobacterium-mediated transformation of rice calli.

    • Screen transformants through herbicide selection (hygromycin).

    • Confirm editing events through PCR amplification and sequencing of target regions.

    • Analyze T0 plants for chimeric mutations and select homozygous mutants in T1/T2 generations .

  • Phenotypic characterization:

    • Given the chloroplastic nature of UPF0603 protein, carefully assess chlorophyll content, chloroplast ultrastructure, and photosynthetic parameters in mutants.

    • Compare mutant phenotypes under various environmental conditions, particularly focusing on temperature stress, as chloroplast proteins often show temperature-dependent phenotypes .

An example workflow for CRISPR/Cas9 editing of UPF0603 protein Os05g0401100, based on successful approaches in rice :

StepProcedureTechnical Considerations
sgRNA designSelect 3-4 target sites in Os05g0401100Prioritize sites with GC content 40-60%, minimal off-targets
Vector assemblyConstruct pYLCRISPR/Cas9Pubi-H with sgRNAsVerify by sequencing before transformation
Rice transformationAgrobacterium-mediated transformationUse Nipponbare or other amenable japonica variety
Mutation screeningPCR amplification and sequencingScreen 20-30 independent T0 lines
Phenotypic analysisChlorophyll measurement, TEM of chloroplasts, RNA-seqCompare with WT under various temperatures (22°C, 30°C)

What are the best experimental approaches for investigating protein-protein interactions of UPF0603 protein Os05g0401100?

To elucidate the functional role of UPF0603 protein Os05g0401100, investigating its protein-protein interactions is crucial. Multiple complementary techniques should be employed:

  • Yeast two-hybrid (Y2H) screening:

    • Use mature UPF0603 protein (without transit peptide) as bait against rice cDNA library.

    • Verify positive interactions by retesting in yeast and through in vitro pull-down assays.

    • Despite limitations with membrane proteins, Y2H can identify soluble interaction partners in the chloroplast stroma .

  • Co-immunoprecipitation (Co-IP) coupled with LC-MS/MS:

    • Generate transgenic rice expressing tagged UPF0603 protein (FLAG or HA tag).

    • Isolate intact chloroplasts from transgenic plants.

    • Perform Co-IP using tag-specific antibodies followed by LC-MS/MS analysis.

    • This approach has successfully identified interaction networks of chloroplast proteins in rice .

  • Proximity-dependent biotin identification (BioID):

    • Express UPF0603 protein fused with biotin ligase (BirA*) in rice.

    • Proteins in proximity to UPF0603 become biotinylated in vivo.

    • Identify biotinylated proteins through streptavidin pull-down and LC-MS/MS.

    • This method is particularly valuable for identifying transient interactions .

  • Split-GFP complementation assays:

    • Express UPF0603 protein fused with one half of GFP and potential interactors fused with the complementary half.

    • Visualize interactions through confocal microscopy in rice protoplasts.

    • This method provides spatial information about interactions within the chloroplast .

  • Nucleotide-dependent interactome analysis:

    • If UPF0603 protein exhibits nucleotide-binding properties (given its sequence similarities to other functional proteins), perform interaction studies in different nucleotide-bound states.

    • This approach has been successfully used for rice G-protein studies and may reveal condition-specific interactions .

A comprehensive approach combining these methods would provide robust evidence for UPF0603 protein interactions. Based on known chloroplast protein networks, potential interacting partners could include proteins involved in plastid ribosome assembly, chloroplast RNA processing, or photosynthetic complex assembly .

How does temperature stress affect the expression and function of chloroplastic proteins like UPF0603 in rice?

Temperature stress significantly impacts chloroplastic protein expression and function in rice, with particular implications for proteins like UPF0603:

  • Transcriptional regulation under temperature stress:

    • Low temperature (below 20°C) often upregulates expression of many chloroplast-targeted proteins involved in chloroplast development and protection.

    • RNA-seq analysis of rice under cold stress reveals complex transcriptional networks affecting chloroplast function .

    • The temperature-dependent expression patterns can be monitored through qRT-PCR analysis of UPF0603 transcripts under various temperature regimes (15°C, 22°C, 28°C, 35°C) .

  • Post-translational modifications and protein stability:

    • Temperature stress can alter phosphorylation patterns of chloroplastic proteins, affecting their activity and stability.

    • Phosphoproteomic analysis using iTRAQ labeling coupled with LC-MS/MS can reveal temperature-dependent modifications of UPF0603 protein .

    • Example workflow for phosphoproteome analysis under temperature stress:

    StepMethodTechnical Details
    Protein extractionTCA/acetone precipitationFrom rice seedlings grown at different temperatures
    Protein digestionTrypsin digestionOvernight at 37°C
    Phosphopeptide enrichmentTiO2 chromatographyFollowing manufacturer protocols
    iTRAQ labeling8-plex iTRAQDifferent temperature treatments with replicates
    LC-MS/MS analysisNano LC-MS/MSOn a hybrid quadrupole-TOF mass spectrometer
    Data analysisDatabase searchingAgainst rice protein database
  • Functional implications in chloroplast development:

    • Low temperature-conditional chloroplast-deficient phenotypes are common in rice mutants affecting chloroplastic proteins.

    • Several rice genes encoding chloroplast-targeted proteins (including PPR proteins, plastid ribosomal proteins, and chaperonins) show temperature-dependent phenotypes when mutated .

    • Mutants lacking functional chloroplastic proteins often exhibit normal phenotypes at optimal temperatures but show albino or chlorotic phenotypes at lower temperatures .

  • Experimental approaches for studying temperature-dependent function:

    • Generate CRISPR/Cas9 knockout lines of UPF0603 protein Os05g0401100.

    • Grow mutant and wild-type plants under different temperature regimes.

    • Analyze chlorophyll content, photosynthetic efficiency, and chloroplast ultrastructure.

    • Perform RNA-seq analysis to identify temperature-dependent changes in gene expression networks affected by UPF0603 protein deficiency .

The available evidence from studies on chloroplastic proteins in rice suggests that UPF0603 protein function may be particularly important under suboptimal temperature conditions, potentially contributing to chloroplast development and maintenance during temperature stress .

What proteomic approaches are most effective for studying low-abundance chloroplastic proteins like UPF0603?

Low-abundance chloroplastic proteins present significant challenges for proteomic analysis. Based on successful approaches for similar proteins, the following strategies are recommended:

  • Optimized chloroplast isolation and subfractionation:

    • Percoll gradient-based isolation of intact chloroplasts from rice leaves.

    • Further fractionation into envelope membranes, thylakoids, and stroma.

    • This targeted approach enriches low-abundance chloroplastic proteins by reducing cytosolic contamination .

    • Verification of fraction purity using Western blotting with marker antibodies (RbcL for stroma, PsbA for thylakoid, Tic40 for envelope).

  • Gel-based approaches with specialized staining:

    • 2D gel electrophoresis with narrow pH gradients (e.g., pH 4-7) for improved resolution.

    • Use of sensitive staining methods (SYPRO Ruby, silver staining) for low-abundance protein detection.

    • This approach allows visualization of protein isoforms and post-translational modifications .

  • Gel-free quantitative proteomics using isobaric labeling:

    • iTRAQ or TMT labeling of peptides from chloroplast extracts.

    • High-resolution LC-MS/MS analysis using nano-flow chromatography.

    • OFFGEL electrophoresis for peptide fractionation prior to LC-MS/MS.

    • This methodology provides superior sensitivity for low-abundance proteins .

    Recommended iTRAQ workflow based on successful rice chloroplast proteomics studies :

    StepProtocol DetailsExpected Outcome
    Protein extraction100 μg protein sample from isolated chloroplastsHigh-purity chloroplast proteins
    Digestion and labelingTrypsin digestion followed by iTRAQ 8-plex labelingLabeled peptides from different conditions
    FractionationHigh pH reverse phase chromatography into 15 fractionsReduced sample complexity
    LC-MS/MS analysisPeptides loaded on C18 trap column and analyzed on TripleTOF 5600Comprehensive peptide identification
    Database searchingRice-specific database with FDR <1%Confident protein identification
  • Targeted proteomics using Selected Reaction Monitoring (SRM)/Multiple Reaction Monitoring (MRM):

    • Development of SRM/MRM assays specific for UPF0603 protein peptides.

    • Use of stable isotope-labeled synthetic peptides as internal standards.

    • This approach provides absolute quantification of specific proteins with high sensitivity .

  • Proximity-dependent labeling for protein interaction networks:

    • Expression of UPF0603 protein fused with proximity-dependent biotin ligase in rice.

    • Identification of biotinylated proteins through streptavidin pull-down and LC-MS/MS.

    • This method provides valuable interaction data even for low-abundance proteins .

These approaches have been successfully applied to study chloroplastic proteins in rice, revealing important insights into their abundance, interactions, and functions in response to various environmental conditions .

How can researchers design experiments to elucidate the role of UPF0603 protein Os05g0401100 in chloroplast development?

To comprehensively investigate the role of UPF0603 protein Os05g0401100 in chloroplast development, a multi-faceted experimental approach is necessary:

  • Genetic perturbation approaches:

    • CRISPR/Cas9 knockout of Os05g0401100 gene to generate null mutants.

    • RNAi-mediated knockdown for partial reduction of expression.

    • Overexpression under constitutive (Ubiquitin) and tissue-specific (chloroplast-specific) promoters.

    • Complementation experiments in knockout lines to verify phenotype rescue .

  • Developmental phenotypic analysis:

    • Germinate seeds and grow plants under controlled conditions (28°C, 14h light/10h dark).

    • Document development at key stages (germination, 1-leaf, 3-leaf, tillering).

    • Measure chlorophyll content using spectrophotometric methods.

    • Analyze chloroplast ultrastructure using TEM at different developmental stages .

  • Transcriptomic analysis of mutant lines:

    • RNA-seq analysis of WT vs. mutant plants at early seedling stage.

    • Focus on differential expression of genes involved in:

      • Chloroplast development (e.g., plastid ribosomal proteins)

      • Chlorophyll biosynthesis

      • Photosynthesis (nuclear and plastid-encoded)

    • qRT-PCR validation of key differentially expressed genes .

  • Chloroplast translation analysis:

    • In vivo labeling of chloroplast proteins using [35S]-methionine in the presence of cytosolic translation inhibitors.

    • Analysis of translation products by SDS-PAGE and autoradiography.

    • This approach can determine if UPF0603 protein affects chloroplast protein synthesis .

  • Environmental condition testing:

    • Given the temperature sensitivity of many chloroplast development mutants, grow plants under multiple temperature regimes (15°C, 22°C, 28°C, 35°C).

    • Test different light intensities and photoperiods.

    • Assess response to nitrogen availability, which affects chloroplast development .

  • Protein-protein interaction analysis:

    • Identify interaction partners of UPF0603 protein using Co-IP coupled with LC-MS/MS.

    • Verify key interactions using BiFC or Y2H approaches.

    • Map interaction domains through deletion analysis .

Experimental design for developmental analysis of UPF0603 mutants:

Developmental StageMeasurementsTechniquesExpected Observations
Seed germinationChlorophyll fluorescencePAM fluorometryEarly differences in photosystem efficiency
3-leaf stageChloroplast structureTEMPotential defects in thylakoid organization
Gene expressionRNA-seq, qRT-PCRChanges in chloroplast development genes
Photosynthetic capacityGas exchangeReduced CO₂ assimilation in mutants
Mature plantsYield componentsTiller number, grain yieldPotential reduction in productivity

This comprehensive approach would provide multiple lines of evidence regarding the function of UPF0603 protein Os05g0401100 in chloroplast development and its impact on rice productivity .

How does nitrate supply interact with chloroplast development pathways potentially involving UPF0603 protein?

Recent research has revealed important connections between nitrogen metabolism and chloroplast development in rice, with potential implications for proteins like UPF0603:

  • Transcriptomic responses to nitrate levels:

    • Varying nitrate concentrations (0.5 mM, 2.5 mM, 5 mM) significantly affect gene expression patterns in rice.

    • Transcriptome analysis shows that high nitrate supply enhances expression of many chloroplast-targeted proteins.

    • These effects are particularly pronounced under stress conditions, such as pathogen infection .

  • Experimental design for nitrate-chloroplast interaction studies:

    • Grow WT and UPF0603 mutant rice plants under different nitrate regimes.

    • Maintain other nutrient elements at constant levels using modified IRRI nutrient solution.

    • Assess chloroplast development, photosynthetic efficiency, and stress responses.

    • An example experimental design based on established protocols :

    Treatment GroupNitrate ConcentrationGrowth PeriodAnalyses
    Low nitrate (LN)0.5 mM NO₃⁻14 daysChlorophyll content, RNA-seq, proteomics
    Normal nitrate (NN)2.5 mM NO₃⁻14 daysChlorophyll content, RNA-seq, proteomics
    High nitrate (HN)5.0 mM NO₃⁻14 daysChlorophyll content, RNA-seq, proteomics
  • Mechanisms connecting nitrate metabolism and chloroplast function:

    • Nitrate metabolism affects photorespiration rates, which in turn influence chloroplast development.

    • High nitrate levels can enhance stress resistance through metabolic changes in chloroplasts.

    • Proteins involved in chloroplast targeting may be regulated by nitrogen availability .

  • Methodological approaches to study nitrate-UPF0603 interactions:

    • Quantify UPF0603 protein expression under different nitrate regimes using targeted proteomics.

    • Perform chloroplast isolation and analyze protein composition changes in response to nitrate.

    • Investigate potential phosphorylation or other post-translational modifications of UPF0603 protein under varying nitrate conditions using phosphoproteomics.

    • Conduct epistasis analyses by crossing UPF0603 mutants with nitrogen metabolism mutants .

  • Connection to biotic stress responses:

    • Nitrate supply affects rice resistance to bacterial leaf blight.

    • Transcriptome analysis reveals that nitrate-dependent disease resistance involves chloroplast-targeted proteins.

    • UPF0603 protein may participate in this response pathway based on its chloroplastic localization .

This research direction could provide valuable insights into the role of UPF0603 protein in mediating the effects of nitrogen availability on chloroplast development and function, potentially leading to agricultural applications for improving rice productivity under varying nitrogen conditions .

What are the challenges and solutions in studying protein-protein interactions within rice chloroplasts?

Investigating protein-protein interactions within rice chloroplasts presents unique challenges and requires specialized approaches:

  • Challenges in chloroplast protein interaction studies:

    • Membrane protein interactions are difficult to study with conventional methods.

    • Transient interactions may be missed during isolation procedures.

    • Low abundance of many chloroplastic proteins limits detection sensitivity.

    • Plant tissue complexity and high proteolytic activity can compromise results.

    • Subcellular compartmentalization in chloroplasts (envelope, stroma, thylakoids) requires specialized fractionation .

  • Optimized Co-IP protocols for chloroplast proteins:

    • Generate transgenic rice expressing epitope-tagged UPF0603 protein.

    • Isolate intact chloroplasts using Percoll gradient centrifugation.

    • Use gentle solubilization conditions (0.5-1% digitonin or n-dodecyl-β-D-maltoside).

    • Include protease inhibitors and perform procedures at 4°C.

    • Cross-linking prior to isolation can capture transient interactions .

  • Advanced protein interaction methodologies:

    • Bimolecular Fluorescence Complementation (BiFC):

      • Express UPF0603 protein fused with N-terminal YFP fragment.

      • Express potential interactors fused with C-terminal YFP fragment.

      • Transform rice protoplasts and visualize interactions via confocal microscopy.

      • This method provides spatial information about interactions within living cells .

    • Förster Resonance Energy Transfer (FRET):

      • Generate CFP-UPF0603 and YFP-interactor fusion proteins.

      • Measure energy transfer between fluorophores when proteins interact.

      • Provides dynamic information about protein interactions in living cells .

    • Proximity-dependent biotin identification (BioID):

      • Express UPF0603-BirA* fusion protein in rice.

      • Proteins in proximity become biotinylated in vivo.

      • Isolate and identify biotinylated proteins through LC-MS/MS.

      • This method can identify weak or transient interactions missed by other approaches .

  • Bioinformatic prediction of interaction networks:

    • Leverage existing chloroplast protein interaction databases.

    • Use co-expression analysis from transcriptomic data to predict functional associations.

    • Apply structure-based prediction tools if structural information is available .

  • Specialized approaches for membrane protein interactions:

    • Membrane yeast two-hybrid (MYTH) system for membrane-associated interactions.

    • Split-ubiquitin system for membrane protein interactions.

    • These methods are particularly valuable if UPF0603 protein associates with chloroplast membranes .

A comprehensive workflow for chloroplast protein interaction studies:

ApproachApplicationAdvantagesLimitations
Co-IP/MSInitial screeningUnbiased identification of interactorsMay miss weak interactions
BiFCVerification of interactionsIn vivo visualization, spatial informationPotential false positives from protein overexpression
BioIDDetection of transient interactionsCaptures weak and transient interactionsRequires genetic modification
FRETDynamic interaction analysisReal-time measurement in living cellsComplex setup and analysis
MYTH/Split-ubiquitinMembrane protein interactionsSpecialized for membrane proteinsLimited to binary interactions

By integrating multiple complementary approaches, researchers can overcome the challenges inherent in studying chloroplastic protein interactions and gain comprehensive insights into the functional network of UPF0603 protein .

Current knowledge gaps and future research directions

Despite recent advances in understanding chloroplastic proteins in rice, significant knowledge gaps remain regarding UPF0603 protein Os05g0401100 (LOC_Os05g33280). Future research should focus on:

  • Functional characterization: Determining the precise molecular function of UPF0603 protein through knockout/knockdown studies and biochemical assays. Current evidence suggests potential roles in chloroplast development, but specific functions remain undefined .

  • Regulation under environmental stresses: Investigating how UPF0603 protein expression and function respond to environmental stresses, particularly temperature and nitrogen availability, which have been shown to affect chloroplast development pathways .

  • Interaction network mapping: Comprehensive identification of UPF0603 protein interaction partners to place it within known chloroplast functional networks, potentially connecting it to established pathways in chloroplast development or photosynthesis .

  • Comparative analysis across rice varieties: Examining potential functional differences of UPF0603 protein between japonica and indica rice subspecies, which could provide insights into subspecies-specific adaptations .

  • Agronomic implications: Exploring whether genetic variation in UPF0603 protein correlates with important agronomic traits, particularly those related to photosynthetic efficiency and stress tolerance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.